Recombinant Streptomyces coelicolor Cobalt transport protein CbiN (cbiN)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Streptomyces coelicolor Cobalt Transport Protein CbiN (cbiN)

The Recombinant Streptomyces coelicolor Cobalt transport protein CbiN (cbiN) is a crucial component of the Energy-Coupling Factor (ECF) transport system, specifically involved in the uptake of cobalt ions in bacteria. This protein is part of a larger complex that facilitates the transport of essential micronutrients across cell membranes. The CbiN protein is characterized as a membrane protein with two transmembrane helices connected by an extracytoplasmic loop, playing a pivotal role in enhancing cobalt transport activity when combined with other components like CbiM .

Structure and Function of CbiN

CbiN is a transmembrane protein with a specific structure that includes two transmembrane helices linked by an extracytoplasmic loop. This loop is crucial for its function, as any deletions within it can abolish transport activity . The protein is expressed in Streptomyces coelicolor, a bacterium known for its complex metabolic processes and secondary metabolite production .

Characteristics of CbiNDescription
Protein TypeTransmembrane Protein
FunctionCobalt Transport
StructureTwo transmembrane helices with an extracytoplasmic loop
Expression SystemIn vitro E. coli expression system
TagN-terminal 10xHis-tagged

Role in Cobalt Transport

CbiN interacts dynamically with other components of the ECF transporter system, such as CbiM, to facilitate cobalt uptake. The interaction between CbiN and CbiM involves loop-loop contacts that are essential for metal insertion into the binding pocket of the transporter . This interaction enhances the activity of the cobalt transporter, making it a critical auxiliary component for efficient cobalt transport.

Research Findings

Research on CbiN has highlighted its importance in cobalt transport. Studies have shown that CbiN can induce significant cobalt transport activity even in the absence of other components like CbiQO . The specific interaction between CbiN and CbiM has been characterized using techniques such as cysteine-scanning mutagenesis and crosslinking, confirming the predicted protein-protein contacts .

Study FindingsDescription
Cobalt Transport ActivityEnhanced by CbiN-CbiM interaction
Loop-Loop InteractionEssential for metal insertion into the binding pocket
CbiN DeletionsAbolish transport activity if the extracytoplasmic loop is deleted

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Dry ice shipments incur additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cbiN; SCO5960; SC7H1.30c; Cobalt transport protein CbiN; Energy-coupling factor transporter probable substrate-capture protein CbiN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
cbiN
Target Protein Sequence
MSRNTRINALLLLAVAALAVLPLVLGLGDHKEEPFAGADAEAETAITEIEPDYEPWFSPL HEPPSGEVESALFALQAALGAGVLAYYFGLRRGRRQGEERASAASGAAAAPGDAPEGD
Uniprot No.

Target Background

Function
Component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, involved in cobalt uptake.
Database Links

KEGG: sco:SCO5960

STRING: 100226.SCO5960

Protein Families
CbiN family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.