Recombinant Streptomyces coelicolor Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize development according to your preference.
Synonyms
lspA; SCO2074; SC4A10.07c; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
lspA
Target Protein Sequence
MAEAERIIGTPDIPDAAGEGQERPDADPEREQQEQEQAPERTRGKRRVAVLFAVALFAYL LDLGSKMLVVAKLEHHEPIEIIGDWLRFAAIRNAGAAFGFGEAFTIIFTVIAAAVIVVIA RLARKLHSLPWAIALGLLLGGALGNLTDRIFRAPGVFEGAVVDFIAPKHFAVFNLADSAI VCGGILIVILSFRGLDPDGTVHKD
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: sco:SCO2074

STRING: 100226.SCO2074

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of LspA in Streptomyces coelicolor?

LspA in S. coelicolor functions as a lipoprotein signal peptidase that cleaves the transmembrane helix signal peptide of lipoproteins as part of the lipoprotein-processing pathway. It performs the critical second step in lipoprotein biogenesis after the initial lipidation performed by lipoprotein diacylglycerol transferase (Lgt). This cleavage is essential for proper lipoprotein maturation and localization in the bacterial cell envelope. Loss of LspA function results in significant growth and developmental defects, indicating its importance in the cellular physiology of S. coelicolor .

What is the relationship between LspA and other enzymes in the lipoprotein biogenesis pathway?

LspA functions as part of a sequential lipoprotein biogenesis pathway that involves multiple enzymes. In Streptomyces, this pathway begins with lipoprotein diacylglycerol transferase (Lgt), which lipidates the conserved cysteine in the lipobox of lipoprotein precursors. LspA then cleaves the signal peptide at this lipidated cysteine. In Streptomyces and other actinobacteria, lipoproteins are further modified by lipoprotein N-acyl transferase (Lnt), which adds a third acyl chain, resulting in triacylated lipoproteins. Interestingly, Streptomyces species are unusual among Gram-positive bacteria because they encode two functional Lnt homologues (Lnt1 and Lnt2), both contributing to efficient N-acylation of lipoproteins. This pathway is critical for proper lipoprotein localization and function in the cell envelope .

What are the most effective methods for expressing and purifying recombinant S. coelicolor LspA?

For recombinant expression of S. coelicolor LspA, researchers should consider membrane protein expression systems optimized for hydrophobic proteins. E. coli-based expression systems using vectors with tightly controlled promoters (like pET or pBAD systems) have been successfully employed for similar membrane proteins. Addition of a C-terminal His-tag facilitates purification while avoiding interference with the N-terminal signal sequence. Critical methodology includes:

  • Expression in E. coli strains specialized for membrane proteins (C41/C43 or LEMO21)

  • Growth at lower temperatures (16-20°C) after induction to reduce inclusion body formation

  • Purification using detergent solubilization (DDM or LDAO have proven effective for similar aspartyl proteases)

  • Size exclusion chromatography as a final purification step to obtain homogeneous protein preparations

While no specific purification protocols for S. coelicolor LspA were provided in the search results, these approaches have been successfully used for LspA from related organisms and could be adapted for S. coelicolor LspA .

How can researchers effectively study the conformational dynamics of LspA?

Conformational dynamics of LspA can be effectively studied using a hybrid experimental approach combining molecular dynamics (MD) simulations with electron paramagnetic resonance (EPR) spectroscopy. This approach has revealed important insights about LspA conformational states:

  • MD simulations: Generate atomistic models of LspA in membrane environments to visualize nanosecond timescale dynamics and identify potential conformational states.

  • Continuous Wave (CW) EPR: Measures fast motions on the nanosecond timescale by introducing spin labels at specific sites on the protein.

  • Double Electron-Electron Resonance (DEER) EPR: Measures distances between spin-labeled sites to determine larger conformational changes.

  • Site-directed spin labeling: Involves introducing cysteine residues at strategic positions (particularly in the periplasmic helix and β-cradle regions) followed by labeling with nitroxide spin labels.

This combined approach has successfully revealed that LspA samples multiple conformations, with the periplasmic helix exhibiting significant flexibility, moving between open, intermediate, and closed states on the nanosecond timescale .

What assays can be used to measure LspA enzymatic activity in vitro?

To measure LspA enzymatic activity in vitro, researchers can employ several complementary approaches:

  • Fluorogenic peptide substrates: Synthetic peptides mimicking the lipobox region and cleavage site, labeled with fluorophore-quencher pairs that increase fluorescence upon cleavage.

  • Mass spectrometry-based assays: Incubating purified LspA with synthesized lipopeptide substrates and analyzing cleavage products using LC-MS/MS to directly monitor signal peptide removal.

  • In vitro translation systems: Coupled transcription-translation systems producing lipoprotein precursors, followed by addition of purified LspA and detection of cleaved products via western blotting.

  • Inhibition assays: Measuring LspA activity in the presence of known inhibitors like globomycin or myxovirescin, which can serve as positive controls for inhibition.

For kinetic analysis, researchers should consider the membrane environment, as LspA is a membrane-embedded enzyme whose activity depends on proper integration into a lipid bilayer. Reconstitution into liposomes or nanodiscs can provide a more native-like environment for activity assays .

What challenges arise when creating lsp deletion mutants in S. coelicolor?

Creating lsp deletion mutants in S. coelicolor presents several significant challenges that researchers must address:

  • Secondary mutations: Cosmid-based mutagenesis methods (like ReDirect PCR targeting) can lead to unintended genetic instability and secondary mutations that complicate phenotypic analysis. In studies of lsp deletion, secondary mutations were found to arise not from the essentiality of lsp but from the mutagenesis method itself.

  • Transient gene duplication: The Redirect method using cosmid St4A10 for targeting lsp results in transient duplication of numerous important cell division genes (ftsZ, ftsQ, ftsW, ftsI, ftsL) and essential cell wall synthesis genes (murG, murD, murX, murF, murE), potentially causing deleterious effects independent of lsp deletion.

  • Complementation issues: Even when lsp is reintroduced to its native locus in deletion mutants, it fails to fully restore wild-type growth rates, indicating potential irreversible effects from the deletion process.

  • Phenotype verification: To confidently attribute phenotypes to lsp deletion rather than secondary effects, researchers should use alternative deletion methods that avoid gene duplication, such as suicide vectors .

How can researchers distinguish between lsp-specific phenotypes and secondary effects in mutant strains?

To distinguish between lsp-specific phenotypes and secondary effects in mutant strains, researchers should implement multiple complementary approaches:

  • Use multiple deletion strategies: Compare phenotypes obtained using different mutagenesis methods, such as:

    • Cosmid-based ReDirect PCR targeting

    • Suicide vector-based mutagenesis (avoiding gene duplication)

    • CRISPR/Cas9 genome editing (recently developed for Streptomyces)

  • Comprehensive complementation analysis:

    • Perform both cis (at native locus) and trans (at ectopic site) complementation

    • Verify restoration of lipoprotein biogenesis biochemically

    • Compare growth rates and developmental progression with wild-type

  • Whole genome sequencing: Resequence genomes of parent strains, deletion mutants, and complemented strains to identify and map secondary mutations.

  • Targeted disruption of identified secondary mutations: Individually disrupt genes identified as carrying secondary mutations in wild-type backgrounds to assess their contribution to observed phenotypes.

Research has shown that secondary mutations (including insertion into a putative small RNA, scr6809) can cause developmental phenotypes, but these are not lsp-specific suppressors. True lsp-specific phenotypes include growth delays, developmental defects, and overproduction of actinorhodin, which persist even when using mutagenesis methods that avoid gene duplication .

What are the specific growth and developmental defects observed in S. coelicolor lsp mutants?

S. coelicolor lsp mutants exhibit distinct and reproducible growth and developmental defects:

  • Colony morphology: Very small and flat colonies compared to wild-type strains.

  • Sporulation: Significant delay in the sporulation process, affecting the normal developmental life cycle.

  • Growth rate: Reduced growth rate that cannot be fully restored even by reintroducing the lsp gene to its native locus.

  • Antibiotic production: Overproduction of the blue-pigmented antibiotic actinorhodin, suggesting dysregulation of secondary metabolism.

  • Membrane composition: Loss of lipoproteins from the cytoplasmic membrane, affecting membrane function and integrity.

These phenotypes are directly attributed to the loss of LspA function and the resulting inability to properly process lipoproteins, rather than secondary mutations. The defects are observed regardless of the mutagenesis method used, confirming their specificity to lsp deletion. Despite these significant defects, lsp is not essential for viability in S. coelicolor, unlike in Gram-negative bacteria .

How does the conformational flexibility of LspA influence its substrate recognition and catalytic activity?

The conformational flexibility of LspA plays a crucial role in its ability to recognize and process diverse lipoprotein substrates:

  • Multiple conformational states: LspA exhibits at least three distinct conformational states:

    • Closed state: The periplasmic helix (PH) occludes the charged active site from the lipid bilayer, with a PH to β-cradle distance of only 6.2 Å.

    • Intermediate state: Partially exposes the active site and may represent a substrate-bound state.

    • Open state: Forms a trigonal cavity that can accommodate the lipoprotein substrate, signal peptide, and diacylglyceryl moiety in the correct orientation for cleavage.

  • Nanosecond timescale dynamics: The periplasmic helix fluctuates on the nanosecond timescale, rapidly sampling different conformations that allow LspA to:

    • Shield charged active site residues from the hydrophobic membrane environment in the absence of substrate

    • Create an accessible binding pocket for substrate entry when needed

    • Accommodate structurally diverse signal peptides from different lipoproteins

  • Active site accessibility regulation: The equilibrium between conformational states serves as a mechanism to regulate substrate access to the catalytic aspartate residues while protecting them from the lipid environment.

These dynamics explain how LspA can process such a wide variety of lipoprotein substrates despite having a relatively conserved active site. The ability to adopt multiple conformations creates an adaptable binding site that can recognize the common lipobox motif while accommodating sequence diversity in signal peptides .

What is the relationship between LspA structure and antibiotic binding?

LspA structure exhibits specific relationships with antibiotic binding that provide insights for drug development:

  • Antibiotic-induced conformational changes: Binding of the antibiotic globomycin shifts the conformational equilibrium of LspA toward intermediate states rather than closed states observed in the apo form. This stabilization of alternative conformations is a key mechanism of inhibition.

  • Multiple binding modes: Antibiotics like globomycin can adopt different orientations within the LspA active site while maintaining similar interactions with the catalytic aspartate residues. This is facilitated by the flexible periplasmic helix.

  • Active site conservation: The catalytic dyad residues and 14 additional highly conserved residues surrounding the active site create a binding pocket with limited tolerance for mutations. This explains why resistance mutations that would impede antibiotic binding would likely also interfere with substrate binding and enzyme function.

  • Antibiotic mechanism: Globomycin binding stabilizes conformations of LspA that inhibit both signal peptide cleavage and substrate binding, effectively blocking the enzyme's function through a conformational mechanism rather than simply occupying the active site.

Understanding these structural relationships is crucial for developing new antibiotics targeting LspA, as compounds that can stabilize non-functional conformations may prove to be effective inhibitors with a reduced likelihood of resistance development .

How do Streptomyces species differ from other bacteria in their lipoprotein biogenesis pathways?

Streptomyces species exhibit several unique characteristics in their lipoprotein biogenesis pathways that distinguish them from other bacteria:

  • Twin arginine transport (Tat) pathway preference: Streptomyces are unusual amongst Gram-positive bacteria because they export large numbers of lipoproteins via the Tat pathway, which typically transports fully folded proteins. Most other bacteria predominantly use the Sec pathway for lipoprotein export.

  • Multiple Lgt enzymes: Some Streptomyces species encode two functional Lgt (lipoprotein diacylglycerol transferase) homologues, while most bacteria possess only one. Both S. coelicolor Lgt1 and Lgt2 are functional and can restore lipoprotein membrane anchoring when expressed in lgt mutants.

  • Dual Lnt enzymes: All Streptomyces species encode two homologues of Lnt (lipoprotein N-acyl transferase). This is particularly unusual as Lnt was long thought to be exclusive to Gram-negative bacteria. Efficient N-acylation in Streptomyces depends on both Lnt1 and Lnt2.

  • Triacylated lipoproteins in Gram-positive bacteria: Like mycobacteria but unlike most other Gram-positive bacteria, Streptomyces produce triacylated lipoproteins through N-acylation, a modification previously thought to be restricted to Gram-negative bacteria.

  • Non-essentiality of pathway components: While lgt and lsp mutants show growth and developmental defects, deletion of lnt1 and lnt2 has no observable effect on growth, development, or virulence, suggesting that N-acylation is dispensable in Streptomyces despite being biochemically active.

These unique features make Streptomyces an important model for understanding the evolution and diversity of lipoprotein biogenesis pathways across bacterial taxa .

Why is LspA considered a promising target for antibiotic development?

LspA is considered an excellent target for antibiotic development for several compelling reasons:

  • Essential in many pathogens: LspA is essential for viability in Gram-negative bacteria and important for virulence in Gram-positive bacteria, making it a broad-spectrum target.

  • Limited resistance development: The highly conserved active site means that resistance mutations that would prevent antibiotic binding would likely also interfere with the enzyme's essential function, creating a high barrier to resistance development.

  • Surface accessibility: As a membrane protein processing extracellular substrates, LspA is more accessible to antibiotics than cytoplasmic targets, potentially improving drug delivery.

  • Existing proof-of-concept inhibitors: Antibiotics like globomycin and myxovirescin have already demonstrated the feasibility of targeting LspA, although they are not commercially viable in their current forms.

  • Unique bacterial target: LspA has no human homologue, potentially allowing for selective toxicity against bacterial pathogens without affecting host cells.

  • Structural understanding: Crystal structures of LspA with bound antibiotics provide templates for structure-based drug design to develop improved inhibitors.

The conformational dynamics of LspA also suggest that compounds stabilizing non-functional conformations could be effective inhibitors, opening additional strategies for drug development beyond active site targeting .

What approaches can be used to screen for novel LspA inhibitors in high-throughput formats?

To screen for novel LspA inhibitors in high-throughput formats, researchers can implement several complementary approaches:

  • Fluorescence-based activity assays:

    • Design fluorogenic peptide substrates containing the LspA cleavage site flanked by fluorophore-quencher pairs

    • Measure increased fluorescence upon cleavage in microplate format

    • Screen compound libraries for inhibition of fluorescence signal

  • Conformational biosensors:

    • Engineer LspA variants with fluorescent proteins or FRET pairs positioned to detect the conformational changes

    • Screen for compounds that lock LspA in inactive conformations

    • This approach targets the conformational dynamics critical to LspA function

  • Structure-based virtual screening:

    • Use MD-derived conformations of LspA to perform in silico docking of compound libraries

    • Prioritize compounds predicted to bind active site or stabilize inactive conformations

    • Validate hits with in vitro assays

  • Whole-cell screening:

    • Screen for compounds that phenocopy lsp deletion in reporter strains

    • Use lipoprotein-reporter fusions to monitor processing defects

    • Secondary validation with purified enzyme assays

  • Fragment-based screening:

    • Use thermal shift assays or NMR to identify small molecular fragments that bind to LspA

    • Build larger inhibitors by linking or growing fragments that bind to adjacent sites

For validation of hits, combinations of biophysical techniques (EPR, MD simulations) with functional assays would confirm mechanism of action and guide optimization efforts .

How conserved is LspA function across different Streptomyces species and other bacterial genera?

LspA function shows significant conservation across bacterial species, with some notable variations:

This conservation makes LspA a valuable model for understanding fundamental aspects of lipoprotein processing across bacteria, while species-specific differences provide insights into evolutionary adaptations of this pathway .

How does the phenotype of lsp deletion in S. coelicolor compare to other bacterial species?

The phenotype of lsp deletion in S. coelicolor shows both similarities and differences compared to other bacterial species:

Bacterial SpeciesViability of lsp DeletionMajor Phenotypic EffectsComplementation Efficiency
S. coelicolorViableGrowth delays, developmental defects, actinorhodin overproductionPartial (sporulation restored but not growth rate)
S. scabiesViableGrowth and developmental defects, moderately reduced virulenceNot fully described
Gram-negative bacteria (e.g., E. coli)LethalNot applicable (essential gene)Not applicable
MycobacteriaViableGrowth defects, reduced virulenceVariable
Other Gram-positive bacteriaGenerally viableSpecies-specific effects on cell envelope integrity and virulenceGenerally successful

Key distinctions of S. coelicolor lsp deletion phenotypes:

  • The inability to fully restore wild-type growth through complementation is unusual

  • The overproduction of actinorhodin suggests unique effects on secondary metabolism regulation

  • The severity of developmental defects reflects the importance of lipoproteins in Streptomyces complex life cycle

These comparative phenotypes provide insights into the diverse roles of lipoproteins across bacterial species and highlight the specialized functions they may serve in morphologically complex bacteria like Streptomyces .

What are the most promising techniques for studying LspA structure-function relationships?

The most promising techniques for elucidating LspA structure-function relationships combine structural biology, simulation, and functional approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Capable of resolving membrane protein structures in near-native environments

    • Could capture LspA in different conformational states, especially if stabilized with nanobodies

    • Potential to visualize LspA with bound substrate in the absence of inhibitors

  • Hybrid experimental-computational approaches:

    • Integrating molecular dynamics simulations with experimental restraints from EPR

    • Time-resolved studies to capture transient conformational states

    • Enhanced sampling techniques to observe rare conformational transitions

  • Time-resolved spectroscopy:

    • Single-molecule FRET to track conformational changes in real-time

    • Stopped-flow fluorescence to monitor binding and catalysis kinetics

    • Potential to correlate structural dynamics with enzyme function

  • Native mass spectrometry:

    • Study intact membrane protein complexes

    • Characterize lipoprotein substrate binding and processing

    • Investigate potential protein-protein interactions

  • Advanced genetic approaches:

    • CRISPR/Cas9 genome editing to create precise mutations

    • Suppressor mutation analysis to identify functional networks

    • Synthetic biology approaches to create minimal functional versions

These techniques could help answer key remaining questions about substrate recognition, catalytic mechanism, and the relationship between conformational dynamics and enzyme function .

What are the critical unanswered questions about S. coelicolor LspA that require further investigation?

Several critical questions about S. coelicolor LspA remain unanswered and require further investigation:

  • Structural determinants of substrate specificity:

    • How does LspA specifically recognize and process both Sec and Tat-translocated lipoproteins?

    • What structural features enable discrimination between proper substrates and other membrane proteins?

    • How do the conformational dynamics contribute to substrate selectivity?

  • Complete catalytic mechanism:

    • What is the precise role of each catalytic residue in the reaction mechanism?

    • How does substrate binding trigger the conformational changes necessary for catalysis?

    • What is the rate-limiting step in the enzymatic reaction?

  • Physiological consequences of lsp deletion:

    • Which specific lipoproteins' loss contributes most significantly to the observed phenotypes?

    • How does lipoprotein processing affect secondary metabolism regulation?

    • What compensatory mechanisms allow S. coelicolor to survive without LspA?

  • Protein-protein interactions:

    • Does LspA interact directly with other components of the lipoprotein biogenesis pathway?

    • Are there auxiliary proteins that facilitate LspA function in vivo?

    • How is LspA activity regulated in response to cellular needs?

  • Evolutionary adaptations:

    • Why is LspA non-essential in Streptomyces while essential in most Gram-negative bacteria?

    • How has LspA evolved to accommodate the unusual preference for Tat-exported lipoproteins in Streptomyces?

Addressing these questions would significantly advance our understanding of bacterial lipoprotein biogenesis and potentially reveal new approaches for antibiotic development .

What are the key implications of S. coelicolor LspA research for broader bacterial physiology studies?

Research on S. coelicolor LspA has revealed several key implications for broader bacterial physiology studies:

  • The non-essentiality of LspA in Streptomyces challenges assumptions about the universal importance of lipoprotein processing across bacterial species and suggests alternative mechanisms may exist in some bacteria.

  • The complex relationship between lipoprotein processing and developmental biology in Streptomyces provides a model for understanding how cell envelope processes influence bacterial differentiation.

  • The unique features of Streptomyces lipoprotein biogenesis, including dual Lgt and Lnt enzymes and Tat pathway preference, highlight the evolutionary diversity of seemingly conserved bacterial pathways.

  • The methodology lessons regarding genetic manipulation caution researchers about the potential unintended consequences of commonly used techniques like cosmid-based mutagenesis.

  • The conformational dynamics observed in LspA exemplify how membrane enzymes can regulate their activity through structural flexibility, potentially representing a common mechanism in membrane protein function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.