Recombinant Streptomyces coelicolor Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms

YidC operates via two primary pathways:

  1. Independent Insertion: Directly integrates hydrophobic membrane proteins into the bilayer without Sec translocase involvement .

  2. Sec Translocase Cooperation: Assists in inserting transmembrane domains of Sec-dependent substrates, particularly for multispanning proteins .

Role in Streptomyces coelicolor

While direct studies on S. coelicolor YidC are sparse, analogous mechanisms from E. coli and other bacteria provide insights:

  • Cooperation with Sec/Tat Pathways: In S. coelicolor, the Rieske protein (Sco2149) requires both Sec and Tat pathways for assembly, with YidC likely inserting initial transmembrane domains .

  • Substrate Recognition: YidC recognizes hydrophobic regions of nascent polypeptides, facilitating their integration into the membrane .

MechanismDescriptionRelevance to S. coelicolor
Independent InsertionDirect integration of Sec-independent substrates (e.g., Foc in E. coli)Likely conserved
Sec Translocase SynergyAssists SecYEG in inserting transmembrane domains (e.g., FtsQ in E. coli)Supported by Sco2149 studies

Production and Recombinant Forms

Recombinant S. coelicolor YidC is produced via heterologous expression in bacterial, yeast, or mammalian systems. Key production parameters include:

ParameterDetailsSource
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity≥85% (SDS-PAGE)
Gene IdentifierSCO3883 (StH24.05)

Functional Mutations

Cold-sensitive yidC mutants (e.g., C423R, P431L) in E. coli highlight critical residues in TM3, which are conserved in S. coelicolor . These mutations impair proton motive force and substrate integration, suggesting similar functional constraints in Streptomyces.

MutationEffectSource
C423RDisrupts TM3 structure, causing cold sensitivity and phage shock response
P431LAlters TM3 conformation, impairing substrate insertion

Comparative Analysis with Other YidC Homologs

The YidC/Oxa1/Alb3 family shows functional divergence:

OrganismYidC HomologPrimary FunctionSubstrates
E. coliYidCIndependent insertion or Sec cooperationFoc, FtsQ, multispan proteins
S. coelicolorSCO3883 (yidC)Sec/Tat cooperation (inferred)Rieske proteins (Sco2149)
MitochondriaOxa1Insertion of mitochondrially encoded proteinsATP synthase subunits

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please specify this in advance, and we will prioritize its development.
Synonyms
yidC; SCO3883; STH24.05; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-431
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
yidC
Target Protein Sequence
MDTIASLFSFITWPVSWVIVQFHTVYGAIFGPDTGWAWGLSIVSLVILIRICLIPLFVKQ IKATRGMQTLQPEMKKIQERYKNDKQRQSEEMMKLYKETGTNPLSSCLPILAQSPFFFAL YHVLNGIASGDTIGKINQPLLESAQKAHIFGAPLAAKFTDGASKVESLGASLTDVRVITA VMIVLMSASQFFTQRQLMTKNVDTSVKTPFMQQQKMLMYVFPVMFAVFGINFPVGVLVYW LTTNVWTMGQQMYVIRNNPTPGSKAQASYLERLHKSVTEHGRTRRRGEKAIVKAIVAKGR DRNEAERKFINGLNKAGLAAQADGNVVKNDAAVAVQSEDGSTVTTTAQPKRQQPKRQSKS QRQAKPAGETEPKTSLTKSDEPQDAEPAGKQDAKPAAGAKKPAQKSGGGGRSKAQSGQRK GPQRPKSPSKK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. YidC is involved in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. It also facilitates the folding of multispanning membrane proteins.
Database Links

KEGG: sco:SCO3883

STRING: 100226.SCO3883

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of YidC insertase in Streptomyces coelicolor?

YidC in S. coelicolor functions as a membrane protein insertase that plays essential roles in both Sec-dependent and Sec-independent membrane protein integration. It helps insert membrane proteins directly into the cytoplasmic membrane, acting as a chaperone that facilitates and accelerates the stepwise insertion and folding process of polytopic membrane proteins . The protein assists in the integration of various membrane proteins including respiratory complexes and components of the cell's energy production machinery. In S. coelicolor, YidC is particularly important for correct membrane protein topology and assembly, ensuring proper cellular function in this complex, filamentous bacterium .

How is YidC structurally organized in S. coelicolor compared to other bacterial species?

The YidC insertase in S. coelicolor contains the characteristic hairpin-interrupted three-transmembrane helix (TMH) motif that is conserved across the YidC family . This core structure includes a membrane-embedded H1/4/5 bundle and a peripheral H0 brace that are crucial for its function . Like other bacterial YidC proteins, the S. coelicolor YidC features a hydrophilic groove that creates a platform for membrane protein insertion. The third transmembrane segment (TM3) has been identified as particularly crucial for YidC function, as evidenced by cold-sensitive mutations in this region that significantly impact YidC activity . Though specific structural details of S. coelicolor YidC are not fully characterized in the provided search results, comparative analysis with homologs suggests conservation of the fundamental structural elements that enable its insertase function.

What experimental approaches are commonly used to study YidC function in S. coelicolor?

Several experimental approaches are commonly employed to study YidC function in S. coelicolor:

  • Genetic manipulation techniques: Creating deletion-insertion mutations or conditional expression systems to study the effects of YidC depletion .

  • Growth phenotype analysis: Measuring biomass and analyzing growth patterns of wild-type versus YidC-deficient strains under various conditions .

  • Protein localization assays: Tracking membrane protein insertion using reporter constructs or tagged proteins to assess YidC-dependent integration .

  • Biochemical isolation methods: Using affinity chromatography with histidine-tagged constructs to purify YidC and associated protein complexes .

  • Proteomic analysis: Employing tandem mass spectrometry to identify changes in the membrane proteome when YidC function is compromised .

These approaches allow researchers to determine how YidC affects the insertion of various membrane proteins and to characterize the consequences of YidC deficiency on bacterial physiology and development.

How does YidC in S. coelicolor interact with other protein secretion pathways?

In S. coelicolor, YidC functions within a complex network of protein secretion pathways. YidC can operate both in conjunction with the Sec translocon (SecYEG) and independently . When working with the Sec pathway, YidC assists in the lateral release and proper folding of membrane proteins that are initially engaged by the Sec machinery. In its Sec-independent role, YidC directly facilitates the insertion of certain membrane proteins into the lipid bilayer .

S. coelicolor also possesses the Twin Arginine Translocation (Tat) pathway, which is particularly prominent in this organism compared to many other bacteria. While YidC primarily handles hydrophobic membrane proteins, the Tat system specializes in transporting folded proteins across the membrane . Evidence suggests that these pathways may work cooperatively in some cases, with YidC potentially assisting in the assembly of certain Tat-dependent membrane protein complexes, though the extent of this cooperation in S. coelicolor specifically requires further research .

How do cold-sensitive YidC mutations affect membrane protein insertion in experimental systems?

Cold-sensitive (CS) YidC mutations provide valuable insights into the functional mechanisms of this insertase. Research has identified critical point mutations in the third transmembrane segment (TM3) of YidC that confer cold-sensitive phenotypes, highlighting this region's importance for proper function . The C423R mutation produces a relatively mild effect on membrane protein insertion, while the P431L mutation causes more severe defects .

These mutations differentially affect various substrate proteins. For instance:

YidC MutationPf3 Coat ProteinATP Synthase F₁F₀ Subunit cCyoAWild-type Procoat
C423R (mild)InhibitedInhibitedMinimal effectMinimal effect
P431L (severe)Strongly inhibitedStrongly inhibitedSlight effectMinimal effect

This substrate-specific impact suggests that different membrane proteins require varying levels of YidC activity for successful insertion . Depletion studies using arabinose-dependent expression systems have further revealed that substrates like -3M-PC-Lep and Pf3 P2 require the highest YidC levels, while CyoA-N-P2 and PC-Lep need the lowest amounts, with ATP synthase subunit c requiring intermediate levels .

These findings demonstrate that cold-sensitive YidC mutations serve as excellent tools for dissecting the specific requirements and mechanisms of membrane protein insertion mediated by YidC.

What is the proposed evolutionary relationship between YidC and SecY, and what evidence supports this hypothesis?

Research suggests a fascinating evolutionary relationship between YidC and SecY, proposing that SecY evolved from a dimeric YidC homologue through gene duplication and fusion . This hypothesis is supported by several lines of evidence:

  • Structural similarities: Both SecY and YidC share a conserved structural core consisting of a membrane-embedded H1/4/5 bundle and a peripheral H0 brace .

  • Helix correspondence: Each consensus helix from the YidC family can be matched to a corresponding consensus helix from proto-SecY, showing the same connectivity patterns .

  • The N.H0 region: The similarity between SecY N.H0 and YidC H0 is particularly strong evidence for homology since this region lacks a direct functional role in SecY and is unlikely to have resulted from convergent evolution .

  • Functional parallels: Both proteins mediate membrane protein integration, albeit through different mechanisms .

  • Dimeric tendencies: The model predicts that YidC should conserve a tendency to form dimers via the same interface as the SecY progenitor, and indeed novel heterodimers formed via this interface have been discovered in archaeal and eukaryotic YidC .

This evolutionary relationship suggests that the protein translocation machinery involving both YidC and SecY has ancient roots, with YidC potentially representing a more primitive form of membrane protein insertase that predates the more complex SecY translocon .

How can researchers develop effective conditional expression systems for studying essential YidC functions?

Developing effective conditional expression systems for studying YidC is crucial since complete deletion may be lethal in many organisms. Based on experimental approaches described in the literature, researchers can implement the following strategies:

  • Arabinose-dependent expression systems: One effective approach uses the arabinose-inducible promoter (PBAD) to control YidC expression levels . This allows for gradual depletion of YidC by shifting cells from arabinose-containing to arabinose-free media, enabling the study of different levels of YidC activity on various substrates.

  • Temperature-sensitive mutants: Isolating cold-sensitive YidC mutants as described in the literature provides a valuable tool for conditional inactivation . These mutants function normally at permissive temperatures but lose function at restrictive temperatures, allowing for temporal control of YidC activity.

  • Redirect PCR targeting approach: For S. coelicolor specifically, the Redirect PCR targeting approach has been successfully used for gene replacement with selectable markers . This technique could be adapted to create conditional YidC mutants by introducing regulated promoters.

  • Complementation constructs: Researchers can design synthetic constructs carrying native or modified promoters joined to the YidC coding sequence, often with epitope tags (such as histidine tags) to facilitate purification and detection . These can be introduced into mutant strains via plasmids or chromosomal integration vectors like pSET152 .

  • Growth monitoring protocols: When implementing conditional systems, carefully monitoring growth parameters through biomass determination provides quantitative measures of YidC essentiality under various conditions .

Each of these approaches offers unique advantages, and researchers may need to combine multiple strategies to fully characterize YidC function in S. coelicolor.

What are the substrate-specific requirements for YidC-mediated membrane protein insertion?

YidC exhibits remarkable substrate specificity in its insertion activity, with different membrane proteins showing varying dependencies on YidC function. Research has revealed several key patterns in these substrate-specific requirements:

  • Hierarchy of YidC dependence: Different membrane proteins require different amounts of YidC activity. Experiments with arabinose-dependent YidC expression systems have established a hierarchy of YidC dependence among various substrate proteins :

    Substrate ProteinRelative YidC Requirement
    -3M-PC-Lep, Pf3 P2Highest
    F₀C (ATP synthase)Moderate
    CyoA-N-P2, PC-LepLowest
  • Charge distribution effects: The presence of negatively charged residues in transmembrane segments significantly increases YidC dependence, as seen with the -3M-PC-Lep construct that contains three negatively charged residues inserted into the middle of the protein .

  • Domain size influence: The addition of large soluble domains (such as the Lep P2 domain) to membrane proteins can increase their reliance on YidC for proper insertion, as demonstrated with the Pf3 P2 construct .

  • Transmembrane topology: The specific arrangement and number of transmembrane segments affect how strongly a protein depends on YidC for insertion. Single-spanning membrane proteins often show different requirements compared to polytopic membrane proteins with multiple transmembrane domains .

  • Folding kinetics: YidC appears to be particularly important for membrane proteins that require assistance with complex folding trajectories or those prone to misfolding during the insertion process .

Understanding these substrate-specific requirements has significant implications for biotechnology applications involving the expression of recombinant membrane proteins in S. coelicolor and other bacterial expression systems.

How does YidC function differ between Streptomyces species and other bacteria like E. coli?

YidC function shows both conservation and divergence between Streptomyces species and other bacteria like E. coli:

  • Essentiality: YidC is essential in E. coli but the essentiality in Streptomyces species may vary depending on growth conditions and the specific functions being studied .

  • Substrate range: In E. coli, YidC primarily mediates the insertion of relatively small membrane proteins or those with limited periplasmic domains. In contrast, Streptomyces YidC may handle a broader range of substrates adapted to the complex cell envelope and developmental stages of these filamentous bacteria .

  • Secretion system integration: While E. coli YidC works primarily with the Sec translocon, Streptomyces species have a particularly prominent Tat secretion system with at least 27 Tat-dependent proteins identified in S. coelicolor, suggesting potentially unique interactions between YidC and the Tat pathway not observed in E. coli .

  • Developmental context: In Streptomyces, YidC function must accommodate the complex developmental cycle involving vegetative growth, aerial mycelium formation, and sporulation, which requires specific membrane protein insertion events not present in unicellular bacteria like E. coli .

  • Genomic context: S. coelicolor possesses homologs of Sec pathway components, including two sets of SecD and SecF homologs, but interestingly, a YajC homolog (which forms a complex with SecD/F in E. coli) does not appear to be present in the related S. lividans 66 genome, suggesting potential differences in how YidC interfaces with other membrane protein biogenesis factors .

These differences highlight the importance of studying YidC in diverse bacterial contexts to fully understand the evolutionary adaptations of this essential membrane protein insertase.

How can researchers effectively express and purify recombinant S. coelicolor YidC for structural and functional studies?

Effective expression and purification of recombinant S. coelicolor YidC requires careful optimization of several parameters. Based on successful approaches with membrane proteins described in the literature:

  • Expression system design:

    • Construct synthetic operons using native S. coelicolor promoters, such as the hrdB (sco5820) promoter, which has been successfully used for other membrane proteins .

    • Incorporate affinity tags (typically decahistidine tags) at either the N- or C-terminus to facilitate purification, taking care not to disrupt transmembrane topology .

    • Consider including native ribosome binding sites if expressing multiple proteins together, as demonstrated in the design of the qcrCAB construct .

  • Host selection:

    • For homologous expression, use S. coelicolor M145 or related strains, introducing the expression construct via intergeneric conjugation using E. coli ET12567/pUZ8002 as a donor strain .

    • For heterologous expression, consider specialized E. coli strains designed for membrane protein expression, though be aware that deliberate truncation or fusion protein strategies may interfere with the targeting route .

  • Growth conditions:

    • For S. coelicolor, use appropriate media such as soy flour mannitol (SFM) agar or modified liquid media .

    • Optimize growth temperature, typically 28-30°C for Streptomyces, with potential adjustments needed for cold-sensitive variants .

  • Membrane preparation:

    • Harvest cells and disrupt by sonication or mechanical methods appropriate for the tough Streptomyces cell wall.

    • Separate membrane fractions by ultracentrifugation through sucrose gradients.

  • Solubilization and purification:

    • Test multiple detergents for optimal solubilization of YidC from membranes.

    • Employ affinity chromatography using Ni-NTA or similar resins to capture histidine-tagged YidC .

    • Consider additional purification steps such as ion exchange or size exclusion chromatography.

  • Functional verification:

    • Assess the activity of purified YidC using reconstitution systems and model substrate proteins such as the Pf3 coat protein or ATP synthase subunit c .

    • Verify correct folding using circular dichroism or limited proteolysis approaches.

This methodological approach should yield pure, functional S. coelicolor YidC suitable for both structural and functional characterization.

What are the optimal methods for analyzing YidC-dependent membrane protein insertion in Streptomyces systems?

Analyzing YidC-dependent membrane protein insertion in Streptomyces requires specialized approaches adapted to this organism's unique physiological characteristics. Based on established methods in the literature:

  • Genetic approaches:

    • Create conditional YidC depletion strains using inducible promoter systems .

    • Generate specific YidC mutations (e.g., cold-sensitive variants) to dissect functional domains .

    • Develop reporter fusion constructs with easily detectable tags or enzymatic activities.

  • Biochemical assays:

    • Membrane fractionation: Separate cytoplasmic and membrane fractions to determine proper localization of target proteins .

    • Protease protection assays: Assess topology of inserted proteins by their sensitivity to externally added proteases.

    • Alkaline extraction: Differentiate between peripheral and integral membrane proteins to confirm proper insertion.

  • Microscopy techniques:

    • Scanning electron microscopy (SEM): Examine morphological effects of YidC deficiency on mycelial filaments .

    • Fluorescence microscopy: Use fluorescently tagged substrate proteins to visualize localization patterns.

    • Transmission electron microscopy (TEM): Examine ultrastructural details of membrane organization in wild-type versus YidC-deficient strains .

  • Proteomic approaches:

    • Comparative proteomics: Compare membrane proteomes between wild-type and YidC-depleted strains using tandem mass spectrometry .

    • Pulse-chase experiments: Track the kinetics of membrane protein insertion using radioactive labeling.

    • Crosslinking studies: Identify interaction partners of YidC during the insertion process.

  • Transcriptional analysis:

    • Monitor stress responses triggered by YidC depletion using RNA sequencing or microarray analysis .

    • Quantify expression changes in genes encoding secretory pathway components.

  • In vitro reconstitution:

    • Establish cell-free translation systems supplemented with Streptomyces membranes or purified components.

    • Perform single-molecule force spectroscopy to analyze the energetics and kinetics of YidC-mediated membrane protein folding, similar to approaches used with other YidC homologs .

These methods, used in combination, provide comprehensive insights into the mechanisms and substrate specificities of YidC-dependent membrane protein insertion in Streptomyces systems.

How can researchers analyze the impact of YidC mutations on bacterial growth and development in S. coelicolor?

Analyzing the impact of YidC mutations on S. coelicolor growth and development requires multi-faceted approaches that account for this organism's complex life cycle. Recommended methods include:

  • Growth rate quantification:

    • Determine total biomass using established protocols similar to those used for other S. coelicolor strains .

    • Monitor growth curves in liquid culture by measuring optical density or dry weight.

    • Track the formation of substrate and aerial mycelia on solid media over time.

  • Developmental phenotyping:

    • Assess sporulation efficiency by quantifying spore formation and viability.

    • Document the timing and extent of aerial mycelium formation, which may be affected if secretion pathways are compromised .

    • Look for the "bald" phenotype (deficient aerial mycelium), which is often associated with secretion defects in Streptomyces .

  • Medium-dependent phenotype analysis:

    • Test growth on both rich media (like R2YE) and minimal media, as some phenotypes are medium-dependent .

    • Vary osmolarity conditions, as high osmolarity (e.g., high sucrose content) can affect the severity of division defects in some Streptomyces mutants .

  • Microscopic examination:

    • Use scanning electron microscopy to examine hyphal morphology and septation patterns .

    • Apply transmission electron microscopy to analyze the ultrastructure of membranes and septa.

    • Employ fluorescence microscopy with membrane-specific dyes to visualize membrane integrity.

  • Molecular characterization:

    • Perform Western blot analysis using antibodies against YidC substrates to assess their proper insertion .

    • Conduct proteomics analysis to identify changes in the membrane proteome.

    • Use quantitative PCR to monitor expression changes in stress-response genes.

  • Antibiotic sensitivity testing:

    • Assess sensitivity to antibiotics that target cell envelope integrity, which might be altered in YidC mutants.

    • Test growth in the presence of antibiotics at various concentrations: ampicillin, kanamycin, chloramphenicol, apramycin, hygromycin B, and nalidixic acid at standard concentrations .

  • Suppressor mutation analysis:

    • Screen for intragenic or extragenic suppressor mutations that overcome the phenotypes of YidC mutations, similar to approaches used with cold-sensitive mutants .

    • Analyze these suppressors to identify functional interactions between YidC and other cellular components.

These comprehensive approaches will provide valuable insights into how YidC mutations affect the complex developmental life cycle of S. coelicolor.

How does S. coelicolor YidC function compare to YidC homologs in other actinobacteria?

S. coelicolor YidC shares fundamental functional characteristics with YidC homologs in other actinobacteria, but also exhibits species-specific adaptations:

  • Conservation of core function: Like YidC proteins in other actinobacteria, S. coelicolor YidC mediates membrane protein insertion through both Sec-dependent and Sec-independent mechanisms . The basic insertase function appears to be conserved across actinobacterial species.

  • Developmental context: In Streptomyces and related filamentous actinobacteria, YidC must support the complex developmental lifecycle involving vegetative growth, aerial mycelium formation, and sporulation . This contrasts with YidC in non-filamentous actinobacteria like Mycobacterium or Corynebacterium, which have different developmental programs.

  • Secretion system integration: S. coelicolor has an expanded Tat secretion system compared to many other bacteria, with 27 experimentally confirmed Tat-dependent proteins . This suggests potential specialized interactions between YidC and the Tat pathway in Streptomyces that may differ from other actinobacteria.

  • Genomic context: While homologs of YidC have been identified across actinobacteria, the genomic organization and regulatory elements may differ. For instance, genes homologous to yajC (which in E. coli forms a complex with SecD/F) have been identified in eleven Streptomyces genomes but appear to be absent in S. lividans 66 .

  • Substrate specificity: The specific membrane protein clients of YidC may vary between different actinobacterial species based on their physiological needs and environmental adaptations. In S. coelicolor, these likely include components of respiratory complexes like the cytochrome bc1 complex .

Comparative studies of YidC across actinobacteria could provide valuable insights into how this essential insertase has evolved to support the diverse lifestyles and physiological demands of this important bacterial phylum.

What interactions exist between YidC and respiratory complexes in S. coelicolor?

YidC in S. coelicolor plays a critical role in the biogenesis and assembly of respiratory complexes, with several key interactions identified:

  • Cytochrome bc1 complex: Research suggests important connections between YidC and the assembly of the cytochrome bc1 complex (encoded by the qcrCAB operon) . While not explicitly stated in the search results, YidC likely facilitates the insertion of hydrophobic components of this complex, particularly cytochrome b, which contains multiple transmembrane helices.

  • Rieske protein insertion: The S. coelicolor Rieske protein (Sco2149), a component of the cytochrome bc1 complex, requires a complex insertion mechanism involving multiple transport pathways . YidC may participate in this process, especially for the transmembrane domains.

  • ATP synthase assembly: YidC is known to be critical for the insertion of ATP synthase F₁F₀ subunit c in bacterial systems . In S. coelicolor, this interaction is likely conserved, making YidC essential for energy production via oxidative phosphorylation.

  • Cytochrome bo3 quinol oxidase: The research indicates that cytochrome bo3 quinol oxidase complex assembly involves YidC, particularly for the insertion of the quinol-binding subunit CyoA . Although the dependency may be less severe than for other substrates, YidC still plays a role in the proper assembly of this respiratory complex.

The interactions between YidC and these respiratory complexes highlight its critical role in energy metabolism. Disruption of YidC function would be expected to compromise respiratory capabilities in S. coelicolor, potentially explaining growth defects observed in YidC mutants. These interactions also suggest that YidC may be particularly important during developmental transitions that involve significant remodeling of the cell's respiratory apparatus.

How does YidC cooperate with the Sec and Tat translocation pathways in S. coelicolor?

YidC in S. coelicolor functions within a complex network of protein translocation systems, cooperating with both the Sec and Tat pathways in distinct ways:

  • YidC-Sec cooperation:

    • YidC can function as an accessory component of the Sec translocon (SecYEG), assisting in the lateral release of transmembrane segments into the lipid bilayer .

    • For certain membrane proteins, YidC may receive partially translocated substrates from the Sec machinery and facilitate their final folding and assembly.

    • This cooperation is particularly important for polytopic membrane proteins with complex topologies that require coordinated insertion.

  • YidC-Tat interactions:

    • While the Tat system primarily translocates folded proteins across the cytoplasmic membrane, YidC may assist with membrane-associated components of Tat substrates .

    • S. coelicolor has an expanded Tat system compared to many other bacteria, with 27 experimentally confirmed Tat-dependent proteins . This suggests potentially specialized YidC-Tat cooperation mechanisms.

    • For Tat-dependent protein complexes that contain membrane-anchored subunits, YidC may facilitate the insertion of these membrane components while the Tat system handles the translocation of the folded, soluble domains.

  • Pathway selection mechanisms:

    • Research on the S. coelicolor Rieske protein (Sco2149) provides an instructive example of pathway cooperation . This protein appears to use both the Sec and Tat pathways for different aspects of its insertion, with the first two transmembrane domains inserted by the Sec pathway (likely with YidC assistance) while the insertion of the third TMD is Tat-dependent .

    • This complex routing of membrane proteins may involve sequential action of YidC with different translocation systems.

  • Stress responses and compensatory mechanisms:

    • When one translocation pathway is compromised, S. coelicolor appears to mount a "translocation stress" response that affects the expression of multiple secretory proteins .

    • YidC may play a role in this stress response, potentially compensating for deficiencies in other pathways under certain conditions.

This interplay between YidC and the Sec and Tat pathways reflects the sophisticated membrane protein biogenesis systems that have evolved in S. coelicolor to support its complex developmental lifecycle and diverse physiological capabilities.

How can YidC mutations be used to optimize membrane protein expression in Streptomyces expression systems?

YidC mutations offer promising approaches to optimize membrane protein expression in Streptomyces-based expression systems:

  • Tuning YidC activity levels:

    • Engineering strains with conditional or moderate overexpression of YidC can enhance the insertion capacity for recombinant membrane proteins .

    • Creating expression hosts with varying levels of YidC activity could provide optimized backgrounds for different classes of membrane proteins based on their YidC dependency .

  • Substrate-specific YidC variants:

    • The differential effects of YidC mutations on various substrates suggest the possibility of engineering YidC variants with enhanced activity for specific classes of membrane proteins .

    • For example, mutations that specifically enhance YidC's interaction with proteins containing negatively charged residues in transmembrane domains could improve expression of this challenging class of membrane proteins.

  • Suppressor mutations as tools:

    • Intragenic suppressors of cold-sensitive YidC mutations provide valuable insights into structure-function relationships .

    • These suppressor mutations could be incorporated into expression strains to enhance specific aspects of YidC function relevant to the target recombinant protein.

  • Coordinated pathway engineering:

    • Since YidC works in conjunction with Sec and Tat pathways, coordinated engineering of these systems could create optimized expression backgrounds for different types of membrane proteins .

    • For complex membrane proteins requiring multiple insertion pathways (like the Rieske protein), fine-tuning the balance between these pathways could improve expression yields .

  • Stress response modulation:

    • Understanding and modulating the "translocation stress" response that occurs when secretion pathways are compromised could help maintain cellular health during high-level membrane protein expression .

    • Engineering strains with enhanced tolerance to membrane protein overexpression stress could improve yields of difficult-to-express targets.

Implementing these strategies requires careful phenotypic characterization and protein expression analysis, but offers significant potential for improving Streptomyces-based membrane protein expression systems for both fundamental research and biotechnological applications.

What techniques can be used to study the structural dynamics of YidC during membrane protein insertion?

Studying the structural dynamics of YidC during membrane protein insertion requires sophisticated biophysical and biochemical approaches. Based on available methods and research findings:

  • Single-molecule force spectroscopy:

    • This technique has been successfully applied to study how insertases like YidC guide the folding of polytopic membrane proteins into membranes .

    • It can reveal the energetics and kinetics of insertion events and identify folding intermediates during YidC-mediated insertion.

  • Site-directed crosslinking:

    • Strategic placement of photo-activatable or chemical crosslinkers within YidC and its substrate proteins can capture transient interaction states.

    • This approach can map the contact points between YidC and substrates during different stages of the insertion process.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • HDX-MS can detect changes in the solvent accessibility of different regions of YidC when it engages with substrate proteins.

    • This provides insights into conformational changes and dynamics during the insertion process.

  • Cryo-electron microscopy (cryo-EM):

    • Cryo-EM can potentially capture YidC in different functional states, especially when bound to substrate proteins or other translocation components.

    • Recent advances in single-particle analysis make it feasible to study membrane protein complexes like YidC with substrates.

  • Fluorescence-based approaches:

    • Förster resonance energy transfer (FRET) between strategically placed fluorophores can monitor distance changes during insertion events.

    • Fluorescence correlation spectroscopy (FCS) can detect binding events and conformational changes at the single-molecule level.

  • Molecular dynamics simulations:

    • Computational modeling of YidC and its interactions with substrates and lipids can provide atomic-level insights into the insertion mechanism.

    • The structural similarities between YidC and SecY identified in the literature provide valuable starting points for these simulations.

  • EPR spectroscopy:

    • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy can measure distances between specific sites and detect conformational changes during substrate engagement.

  • Accessibility studies:

    • Using cysteine scanning mutagenesis combined with sulfhydryl-reactive probes can map the accessibility of different regions of YidC during the insertion process.

These complementary approaches can provide a comprehensive picture of how YidC facilitates membrane protein insertion, potentially revealing the molecular basis for its substrate specificity and cooperation with other translocation pathways.

How can knowledge of YidC function inform strategies for antibiotic development targeting Streptomyces pathogens?

While Streptomyces species are predominantly soil bacteria known for producing antibiotics rather than causing disease, knowledge of YidC function could inform antibiotic development strategies against related actinobacterial pathogens like Mycobacterium tuberculosis. Several approaches emerge from our understanding of YidC:

  • Exploiting essential YidC functions:

    • YidC is essential for viability in many bacteria, making it a potential antibiotic target .

    • Compounds that selectively inhibit YidC function could disrupt membrane protein biogenesis, compromising cellular integrity and function.

    • The cold-sensitive regions identified in YidC, particularly in TM3, represent potential binding sites for small molecule inhibitors .

  • Targeting pathway cooperation:

    • The cooperation between YidC and the Sec/Tat pathways presents opportunities for developing combination therapies that target multiple components of the protein translocation machinery .

    • Such multi-target approaches could reduce the likelihood of resistance development.

  • Substrate-specific interference:

    • Knowledge of substrate-specific YidC requirements could inform the development of compounds that selectively block insertion of essential membrane proteins like respiratory complex components .

    • The hierarchy of YidC dependence among different substrates suggests that even partial inhibition might selectively affect certain critical proteins .

  • Exploiting species-specific features:

    • Comparative analysis of YidC across different actinobacteria could reveal species-specific features that might be selectively targeted .

    • The unique aspects of YidC in actinobacteria compared to human insertases (like SGTA or the EMC complex) provide a basis for selectivity.

  • Stress response modulation:

    • Understanding the "translocation stress" response triggered by YidC dysfunction could reveal additional targets for antibiotic development .

    • Compounds that enhance this stress response might act synergistically with YidC inhibitors.

  • Structure-based drug design:

    • The structural insights into YidC function, particularly the critical role of the third transmembrane segment and its evolutionary relationship with SecY, provide a foundation for rational drug design approaches .

    • Virtual screening against structural models of actinobacterial YidC could identify lead compounds for development.

While developing antibiotics that target YidC presents technical challenges, the essential nature of this insertase and its central role in membrane protein biogenesis make it a promising target for next-generation antimicrobials against actinobacterial pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.