Recombinant Streptomyces coelicolor NADH-quinone oxidoreductase subunit K 1 (nuoK1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of any specific tag requirements for prioritized development.
Synonyms
nuoK1; SCO4605; SCD39.05; NADH-quinone oxidoreductase subunit K 1; NADH dehydrogenase I subunit K 1; NDH-1 subunit K 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
nuoK1
Target Protein Sequence
MHLAYPAVLSALLFCTGLYGVLARRNAILVLMSVELMLNAVNLNLVAFDVWLSRAAEETL HSGQALTLFTIAIAAAEIGIGLAIVLAVHRNRGTSDIDKLRDTAEGHEPDGPDTDTPATG TAAEKAEATA
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled with proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving energy within a proton gradient.
Database Links

KEGG: sco:SCO4605

STRING: 100226.SCO4605

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase and what is its role in Streptomyces coelicolor?

NADH-quinone oxidoreductase (NDH) functions as a critical enzyme in Streptomyces coelicolor's electron transport chain, catalyzing the two-electron reduction of quinones and a wide range of other organic compounds. Its physiological role includes reducing free radical load in cells and detoxifying xenobiotics. In bacterial systems, NDH-2s (type 2 NADH dehydrogenases) are particularly important as alternative enzymes to the proton-pumping Complex I, especially in organisms like S. coelicolor that thrive in diverse environmental conditions .

Structurally, NADH-quinone oxidoreductase is a homodimer with two active sites located at the interface between subunits, meaning both active sites comprise residues from both subunits. The FAD cofactor forms part of these active sites, and the NAD(P)H substrate binds in a parallel orientation to the FAD, facilitating efficient electron transfer .

How does nuoK1 differ from other NADH-quinone oxidoreductase subunits in S. coelicolor?

The nuoK1 subunit is part of the membrane domain of the NADH-quinone oxidoreductase complex in S. coelicolor. While the complete complex consists of multiple subunits that perform different functions, nuoK1 specifically contributes to the proton translocation machinery. Unlike peripheral subunits involved in electron acceptance from NADH, nuoK1 is integrated into the membrane domain and participates in coupling electron transfer to proton pumping across the membrane.

What distinguishes nuoK1 is its specific topological arrangement within the membrane, featuring transmembrane helices that contribute to forming the proton translocation pathway. Compared to other membrane subunits, nuoK1 has unique amino acid residues that facilitate proton movement through the complex, making it essential for energy conservation during respiration in S. coelicolor .

What are the known regulatory mechanisms affecting nuoK1 expression in S. coelicolor?

The expression of nuoK1 in S. coelicolor is regulated through multiple mechanisms that respond to environmental and metabolic conditions:

  • Promoter-based regulation: Similar to other metabolic genes in S. coelicolor, nuoK1 expression is likely controlled by specific promoters that respond to environmental signals. Streptomycetes utilize various promoters, including constitutive ones like vsip from S. venezuelae, dagp from S. coelicolor, and ermE*p, which can be employed for recombinant expression systems .

  • Growth phase-dependent regulation: Expression of respiratory chain components including nuoK1 typically shows growth phase-dependent patterns, with differential expression between exponential and stationary phases, as observed with other metabolic genes in S. coelicolor .

  • Oxidative stress response: Since NADH-quinone oxidoreductase plays a role in managing oxidative stress, nuoK1 expression may be upregulated under conditions that increase cellular reactive oxygen species (ROS), providing a protective mechanism .

  • Carbon source availability: The regulation of respiratory chain components in S. coelicolor responds to available carbon sources, with different expression patterns observed under varying nutrient conditions .

What are the optimal promoter systems for expressing recombinant nuoK1 in Streptomyces coelicolor?

For optimal expression of recombinant nuoK1 in S. coelicolor, several promoter systems have demonstrated effectiveness:

  • Strong constitutive promoters: The ermE* promoter from Saccharopolyspora erythraea shows strong constitutive expression and is widely used for recombinant protein production in streptomycetes .

  • Synthetic promoter libraries (SPL): A customized approach using synthetic promoters can modulate expression levels. As demonstrated with actII orf4 expression, SPL technology can generate promoters with varying strengths:

PromoterRelative StrengthGrowth Rate ImpactProduction Phase Characteristics
Native1.0 (reference)μexp = 0.11 h-1Sequential RED then ACT production
SPL202.85× higherμexp = 0.11 h-1Earlier onset of RED and ACT production
oxp-actII2.57× higherμexp = 0.10 h-1Parallel growth and antibiotic production

The SPL approach allows fine-tuning of expression levels, which is particularly valuable when expressing membrane proteins like nuoK1 where excessive overexpression might be detrimental .

  • Inducible promoters: For controlled expression, tipA promoters that respond to thiostrepton induction can provide temporal control over nuoK1 expression, which is advantageous for studying protein function or when overexpression might be toxic .

How can I optimize codon usage for recombinant nuoK1 expression in heterologous hosts?

Optimizing codon usage for recombinant nuoK1 expression requires a systematic approach:

  • Analyze native codon bias: First, analyze the codon usage pattern of native nuoK1 in S. coelicolor and compare it with the intended expression host. Streptomycetes have a characteristically high GC content (often >70%), which creates distinct codon preferences .

  • Identify rare codons: Identify rare codons in the nuoK1 sequence that might cause translational pausing or premature termination in the expression host. These should be replaced with synonymous codons that are more frequently used in the host.

  • Maintain secondary structure elements: When modifying codons, preserve RNA secondary structure elements that might be important for translation efficiency. This is particularly important for membrane proteins like nuoK1.

  • Optimize 5' region: The first 40-50 nucleotides of the coding sequence significantly impact translation initiation efficiency. Consider replacing the native leader sequence with that of a highly expressed gene (like the glycolytic gene pgi2) to ensure stability of the transcript, as was demonstrated for actII orf4 expression .

  • Gene synthesis: Rather than attempting to modify the native gene, de novo synthesis of the entire nuoK1 gene with optimized codons is often more effective and economical for achieving high expression levels.

What signal peptides are most effective for secretion of recombinant proteins in Streptomyces coelicolor?

While nuoK1 is a membrane protein and not naturally secreted, this question addresses important considerations for other recombinant proteins expressed in S. coelicolor:

Streptomycetes have a natural aptitude for secreting proteins into the extracellular medium, making them attractive hosts for recombinant protein production . The most effective signal peptides include:

  • Native Streptomyces signal peptides:

    • Sec-dependent signal peptides from highly secreted endogenous proteins like amylases or cellulases

    • The signal peptide from S. coelicolor agarase (DagA)

    • The signal peptide from S. lividans xylanase A

  • Heterologous signal peptides:

    • The Sec-dependent signal peptide from Bacillus subtilis alpha-amylase

    • The TAT-dependent signal peptide from S. coelicolor phospholipase D

  • Hybrid signal peptides: Engineered combinations of different signal peptides can sometimes outperform natural ones by optimizing both processing efficiency and compatibility with the target protein.

When selecting a signal peptide, consider whether the target protein requires co-translational (Sec pathway) or post-translational (TAT pathway) translocation, as this affects folding state during transport .

What are the most reliable methods for measuring NADH-quinone oxidoreductase activity in Streptomyces extracts?

Reliable measurement of NADH-quinone oxidoreductase activity in Streptomyces extracts requires careful consideration of assay conditions:

  • Spectrophotometric assays:

    • NADH oxidation: Monitor the decrease in absorbance at 340 nm as NADH is oxidized to NAD+ (ε = 6,220 M-1cm-1).

    • Dichlorophenolindophenol (DCPIP) reduction: Measure the decrease in absorbance at 600 nm as DCPIP is reduced (ε = 21,000 M-1cm-1).

    • Cytochrome c reduction: In coupled assays, monitor reduction of cytochrome c at 550 nm.

  • Oxygen consumption assays:

    • Use oxygen electrodes (Clark-type) to measure oxygen consumption rates in the presence of NADH and appropriate quinone substrates.

  • Inhibitor sensitivity profiling:

    • Differential inhibition with specific compounds like dicoumarol (Ki = 50 pM for rat enzyme; Kd = 120 nM for human enzyme) can help distinguish between different quinone oxidoreductases .

When working with membrane proteins like nuoK1, it's essential to optimize membrane preparation methods:

  • Use gentle detergents that maintain native structures (e.g., n-dodecyl-β-D-maltoside)

  • Prepare inverted membrane vesicles to access the cytoplasmic side of the complex

  • Control pH carefully (typically 7.4-7.6) to maintain optimal enzyme activity

How can I distinguish between type 1 and type 2 NADH dehydrogenase activities in Streptomyces coelicolor?

Distinguishing between type 1 (NDH-1, proton-pumping) and type 2 (NDH-2, non-proton-pumping) NADH dehydrogenase activities requires multiple complementary approaches:

  • Inhibitor profiling:

    • NDH-1 (Complex I) is sensitive to rotenone and piericidin A

    • NDH-2 is insensitive to these inhibitors but may be inhibited by flavone or diphenyleneiodonium

  • Proton translocation measurement:

    • Only NDH-1 pumps protons, so measuring proton translocation using pH-sensitive dyes or proton flux assays can distinguish the activities

    • Create artificial proton gradients and measure their effect on reverse electron transport

  • Genetic approach:

    • Create specific knockout strains lacking either NDH-1 (by targeting nuoK1) or NDH-2

    • Characterize NADH oxidation activities in these strains to identify the contribution of each complex

  • Biochemical separation:

    • Different detergent sensitivities can be exploited to selectively solubilize NDH-2 while leaving NDH-1 in the membrane fraction

    • Blue native PAGE followed by activity staining can separate the complexes based on size differences (NDH-1 is much larger than NDH-2)

  • Kinetic analysis:

    • NDH-1 and NDH-2 typically have different kinetic parameters (Km and Vmax) for NADH and quinone substrates

    • Analyze enzyme kinetics in the presence of specific inhibitors to determine the contribution of each complex

What are the optimal conditions for solubilizing and purifying recombinant nuoK1 from Streptomyces coelicolor membranes?

Purification of membrane proteins like nuoK1 from S. coelicolor requires careful optimization:

  • Cell disruption:

    • For Streptomyces, high-pressure homogenization works well for cell disruption while preserving membrane protein integrity

    • Addition of DNase I helps reduce viscosity during processing

  • Membrane preparation:

    • Differential centrifugation to separate membrane fractions (30,000-150,000 × g)

    • Washing membranes with low-salt buffer to remove peripheral proteins

  • Solubilization:

    • Mild detergents are critical: n-dodecyl-β-D-maltoside (DDM) at 1-2% or digitonin at 1-2% are good starting points

    • Maintain buffer pH between 7.2-7.8 with sufficient ionic strength (150-300 mM NaCl)

    • Include glycerol (10-20%) to stabilize the protein during solubilization

    • Perform solubilization at 4°C for 1-2 hours with gentle agitation

  • Purification strategy:

    • Affinity chromatography using His-tag or Strep-tag is most effective for recombinant nuoK1

    • When using His-tags, add low concentrations of imidazole (10-20 mM) during binding to reduce non-specific interactions

    • Critical for membrane proteins: maintain detergent above CMC in all buffers

  • Stabilization post-purification:

    • Consider reconstitution into nanodiscs or proteoliposomes for functional studies

    • For structural studies, add lipids (0.1-0.5 mg/ml) to stabilize the protein

How does phase variation affect the expression of respiratory chain components like nuoK1 in Streptomyces coelicolor?

Phase variation in S. coelicolor significantly impacts the expression of various genes, potentially including respiratory chain components like nuoK1. The phase-variable phage growth limitation (Pgl) system in S. coelicolor demonstrates how genetic mechanisms can cause phenotypic switching .

The primary mechanism identified for phase variation in S. coelicolor involves the expansion and contraction of a polyguanine tract within the pglX gene, as shown in this data from various S. coelicolor strains:

S. coelicolor strain(s)Pgl statusLength of G tract (bases)
A200+8
B135 Pgl−pglW::IS 1648 (class B)8
B140+8
J1902pglX and pglY and/or pglZ (class AB)7
J1903pglX and pglY or pglZ (class AB)9
J1973pglX (class B)9

Similar mechanisms may impact nuoK1 expression if homopolymeric tracts are present in its regulatory regions or coding sequence. Additionally, nuoK1 expression could be subject to:

  • Epigenetic mechanisms: DNA methylation patterns that change in response to environmental conditions

  • Growth phase-dependent regulation: As observed with antibiotic production genes, respiratory chain components may show differential expression between growth phases

  • Mobile genetic element insertion: Transposons or insertion sequences can disrupt gene expression, similar to IS1648 insertion in pglW

For investigating phase variation in nuoK1:

  • Sequence analysis of the nuoK1 locus across multiple S. coelicolor isolates to identify potential hypervariable regions

  • Reporter gene fusions to monitor expression patterns across populations

  • Single-cell analyses to detect heterogeneity in expression levels within clonal populations

What is the stoichiometry of proton translocation per electron in the Streptomyces coelicolor Complex I containing nuoK1?

Determining the proton translocation stoichiometry for Complex I containing nuoK1 in S. coelicolor requires sophisticated bioenergetic analyses:

  • Isolated enzyme measurements:

    • Reconstitute purified Complex I into proteoliposomes

    • Measure proton uptake using pH-sensitive fluorescent dyes (e.g., ACMA or pyranine)

    • Simultaneously monitor electron transfer (NADH oxidation) spectrophotometrically

    • Calculate the H+/e- ratio from the correlation between proton translocation and electron transfer rates

  • Whole-cell measurements:

    • Use respiratory inhibitors to isolate Complex I contribution to proton motive force generation

    • Measure proton extrusion using pH electrodes or fluorescent probes

    • Monitor oxygen consumption rates simultaneously

    • Apply the stoichiometric relationship between oxygen consumption and electron transfer to calculate H+/e- ratio

  • Genetic approach:

    • Create point mutations in conserved charged residues of nuoK1

    • Analyze how these mutations affect proton pumping efficiency

    • Compare wild-type and mutant strains to establish structure-function relationships

The typical stoichiometry for bacterial Complex I is 3-4 H+/2e-, but this may vary in S. coelicolor depending on environmental conditions and the specific composition of the complex. The precise contribution of nuoK1 to this stoichiometry can be determined by comparative studies with nuoK1 variants or mutants.

How do structural differences in nuoK1 affect substrate specificity and inhibitor sensitivity compared to homologous proteins in other organisms?

Structural differences in nuoK1 can have profound effects on substrate specificity and inhibitor sensitivity:

  • Substrate binding pocket variations:

    • Differences in amino acid residues lining the quinone binding site can alter binding affinities for different types of quinones (ubiquinone, menaquinone, etc.)

    • These structural variations can be analyzed using homology modeling based on resolved structures of Complex I from other organisms

  • Inhibitor sensitivity profiles:

    • NQO1 (NAD(P)H quinone oxidoreductase 1) is known to be inhibited by dicoumarol with a Ki of 50 pM (rat) and Kd of 120 nM (human)

    • Comparing inhibition constants of various compounds against S. coelicolor nuoK1 with those of homologous proteins can reveal structural differences in binding sites

  • Proton translocation pathway:

    • Variations in the transmembrane helices of nuoK1 affect the formation of the proton translocation pathway

    • Conserved charged residues within these helices are critical for proton transfer

    • Site-directed mutagenesis of these residues can reveal their importance in nuoK1 function

  • Comparative analysis approach:

    • Align sequences of nuoK1 homologs from different organisms

    • Identify regions of high conservation (functionally crucial) versus high variability

    • Correlate structural differences with functional differences in enzyme kinetics, substrate preference, and inhibitor sensitivity

The dicoumarol binding site provides a structural example of inhibitor interaction: this compound binds in a conformation that partially overlaps with the FAD cofactor, explaining its ability to act as a competitive inhibitor with respect to NAD(P)H .

How can I interpret contradictory results between in vitro and in vivo studies of nuoK1 function?

Contradictions between in vitro and in vivo studies of nuoK1 function are common due to the complex nature of membrane proteins and their cellular context. Use this systematic approach to reconcile disparate results:

What bioinformatic approaches are most useful for predicting nuoK1 structure-function relationships?

For predicting nuoK1 structure-function relationships, several bioinformatic approaches prove particularly valuable:

  • Multiple sequence alignment and conservation analysis:

    • Align nuoK1 sequences across diverse species to identify conserved residues

    • Use ConSurf or similar tools to map conservation onto structural models

    • Highly conserved residues typically indicate functional importance, particularly for catalytic or structural roles

  • Homology modeling:

    • Utilize resolved structures of homologous proteins (e.g., bacterial Complex I structures from Thermus thermophilus)

    • Validate models using ProCheck or MolProbity to assess stereochemical quality

    • Integrate experimental constraints from crosslinking or spectroscopic data when available

  • Molecular dynamics simulations:

    • Perform atomistic simulations in explicit membrane environments

    • Analyze protein stability, conformational changes, and potential proton pathways

    • Identify water molecules and residues involved in proton translocation

  • Coevolution analysis:

    • Methods like Direct Coupling Analysis (DCA) can predict residue-residue contacts

    • These predictions can validate or refine structural models, particularly for transmembrane regions

    • Apply statistical coupling analysis to identify networks of functionally related residues

  • Protein-protein interaction prediction:

    • Dock nuoK1 models with other Complex I subunits to understand interface interactions

    • Use computational alanine scanning to identify hotspot residues at subunit interfaces

    • Predict the impact of mutations on complex assembly and stability

How does the redox state of Streptomyces coelicolor affect the performance of recombinant nuoK1 in electron transport?

The redox state of S. coelicolor significantly influences the performance of recombinant nuoK1 in electron transport through multiple mechanisms:

  • NAD+/NADH ratio effects:

    • The intracellular ratio of NAD+/NADH affects electron availability for the respiratory chain

    • NQO1 has been shown to regulate this ratio, which subsequently impacts oxidative stress levels and apoptosis pathways in other systems

    • In S. coelicolor, the NAD+/NADH ratio fluctuates between growth phases and in response to environmental stressors

  • Redox-sensitive transcriptional regulation:

    • Promoter activity can be redox-sensitive, affecting expression levels of recombinant nuoK1

    • As observed with other metabolic genes, expression patterns change between exponential and stationary phases, correlating with shifts in cellular redox state

    • Synthetic promoter libraries can be employed to modulate expression under different redox conditions

  • Post-translational modifications:

    • Redox-sensitive modifications (e.g., disulfide bond formation, glutathionylation) can alter nuoK1 function

    • These modifications may affect protein stability, substrate binding, or interactions with other Complex I subunits

    • Specific experimental techniques to investigate these include:

      • Differential alkylation labeling of cysteine residues

      • Redox proteomics to identify modification sites

      • Activity assays under varying redox potentials

  • Membrane composition changes:

    • Oxidative stress can alter membrane lipid composition through peroxidation

    • These changes affect membrane fluidity and potentially disrupt the function of membrane proteins like nuoK1

    • Lipid analysis by mass spectrometry can correlate membrane composition with nuoK1 activity under different redox conditions

For comprehensive analysis, researchers should:

  • Monitor cellular redox state using fluorescent probes or redox-sensitive GFP variants

  • Correlate nuoK1 activity with measurements of reactive oxygen species levels

  • Apply redox proteomic approaches to identify specific modifications on nuoK1 under different conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.