Recombinant Streptomyces coelicolor NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Shipped with Ice Packs
In Stock

Description

Biochemical Role and Context

Complex TypeFunctionStreptomyces coelicolor Evidence
NDH-1Proton-pumping NADH dehydrogenaseAbsent (no annotated genes)
NDH-2Non-proton-pumping NADH dehydrogenasePresent (multiple isoforms)

Recombinant Production and Applications

Recombinant nuoK2 from Streptomyces coelicolor is commercially available as a His-tagged protein for structural or functional studies. Key details include:

ParameterValue
AA SequenceMVPLSWSILLGVALFVIGAGGVLLRRNILIVLMSLELLLNSVNINFIAFGQYYDDFRGQI FAIFVIAITAAEVAVALGILVALVRNKSTLKVDDVTIMKG
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Purity>90% (SDS-PAGE)
UsageBiochemical assays, structural studies, or interaction mapping

Research Gaps and Challenges

Despite its availability, detailed functional studies on Streptomyces coelicolor’s nuoK2 are scarce. Critical unknowns include:

  • Substrate Specificity: Does nuoK2 prefer NADH or NADPH? (This varies across NDH-2 isoforms .)

  • Redox Partners: Which quinones (e.g., menaquinone) interact with the enzyme?

  • Regulatory Role: Does nuoK2 influence antibiotic biosynthesis or developmental transitions?

Comparative Insights from Related Organisms

While direct data on Streptomyces coelicolor’s nuoK2 is lacking, insights from homologous systems suggest potential roles:

OrganismKey Findings
Sinorhizobium medicaeNuoK2 (Smed_3629) is part of NDH-1, critical for symbiotic nitrogen fixation .
E. coliNDH-2 isoforms (e.g., Ndh) regulate NAD⁺/NADH balance in catabolic pathways .

Future Directions

To advance understanding of Streptomyces coelicolor’s nuoK2, researchers should prioritize:

  1. Catalytic Characterization: Kinetic assays to determine substrate affinity (e.g., NADH vs. NADPH).

  2. Structural Analysis: X-ray crystallography or cryo-EM to map quinone-binding sites.

  3. Functional Knockouts: Assessing metabolic impacts in ΔnuoK2 mutants.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK2; SCO4572; SCD16A.11c; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
nuoK2
Target Protein Sequence
MNPVNYLYLAALLFTIGATGVLIRRNAIVVFMCIELMLNACNLAFVAFSRMHGNLDGQII AFFTMVVAAAEVVVGLAIIVSLFRSRHSASVDDASLMKL
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be a menaquinone. This process couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy in a proton gradient.
Database Links

KEGG: sco:SCO4572

STRING: 100226.SCO4572

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the NADH-quinone oxidoreductase complex in Streptomyces coelicolor?

NADH-quinone oxidoreductase (Complex I) in S. coelicolor is part of the respiratory electron transport chain and consists of multiple subunits encoded by genes in the nuo cluster (SCO4599-4608) . This complex transfers electrons from NADH to quinones, contributing to the proton gradient required for ATP synthesis. Unlike some other bacteria, S. coelicolor's respiratory chain has specialized features, including the absence of soluble cytochrome c, replaced by a membrane-associated diheme c-type cytochrome (QcrC) .

How does nuoK2 differ from other NADH dehydrogenase subunits in S. coelicolor?

The nuoK2 subunit represents a second copy of the K subunit in S. coelicolor's NADH-quinone oxidoreductase complex. While the standard nuoK (encoded within the main gene cluster SCO4599-4608) serves as the primary component, nuoK2 likely emerged through gene duplication and may serve specialized functions under particular growth conditions or developmental stages. The expression of nuoK2 appears to be developmentally regulated, with changes occurring during the transition from vegetative growth to aerial mycelium formation .

What is the genomic context of nuoK2 in S. coelicolor?

Unlike the primary nuo gene cluster (SCO4599-4608) that encodes the standard 10 subunits of NADH dehydrogenase, nuoK2 is located elsewhere in the genome. This genomic separation suggests potential independent regulation, possibly linked to specific physiological conditions or developmental stages during S. coelicolor's complex life cycle, which includes aerial mycelium formation and sporulation .

How is nuoK2 expression regulated during S. coelicolor development?

The expression of nuoK2 appears to be developmentally regulated, with changes corresponding to the transition from vegetative growth to aerial mycelium formation. Microarray analyses of developmental mutants (particularly whiI mutants) indicate that several respiratory chain components show altered expression during aerial growth . The WhiI regulator, which influences gene expression during sporulation, may indirectly affect nuoK2 expression as part of broader metabolic adaptations during aerial growth into nutrient-limited environments .

What culture conditions optimize recombinant nuoK2 expression?

For optimal expression of recombinant nuoK2, consider these key parameters:

  • Growth medium: S. coelicolor grows well in SFM (Soya Flour Mannitol) agar for solid cultures and TSB (Tryptic Soy Broth) for liquid cultures .

  • Growth phase: Harvest cells during transition from vegetative to aerial growth (approximately 36-48 hours in standard culture conditions).

  • Temperature: 28-30°C is optimal for S. coelicolor growth and protein expression.

  • Expression system: For heterologous expression, consider using S. coelicolor "superhost" strains such as M1146 (Δact Δred Δcpk Δcda) or M1152, which have reduced secondary metabolite production, allowing better resource allocation to your recombinant protein .

  • Induction: If using an inducible system, thiostrepton (for tipA promoter) or tetracycline (for tetO promoter) are commonly used inducers for Streptomyces.

What evidence suggests developmental regulation of NADH dehydrogenase components in S. coelicolor?

Transcriptome analyses comparing wild-type S. coelicolor with developmental mutants (particularly whiI mutants) revealed that components of the NADH dehydrogenase complex show altered expression during aerial development. Specifically, genes in the SCO4599-4608 cluster (encoding NADH dehydrogenase subunits) showed reduced expression during aerial growth, suggesting downregulation of oxidative phosphorylation during this developmental stage . This pattern indicates a metabolic shift as hyphae transition from a nutrient-rich substrate to the nutrient-limited aerial environment.

What are the optimal methods for isolating recombinant nuoK2 protein from S. coelicolor?

Isolation of recombinant nuoK2 from S. coelicolor requires specialized approaches due to its membrane-associated nature. A recommended protocol includes:

  • Culture growth and harvesting:

    • Grow cultures in TSB medium until optimal expression (36-48 hours)

    • Harvest cells by centrifugation (8,000 × g, 15 min, 4°C)

    • Wash cell pellet with buffer (50 mM Tris-HCl, pH 7.5, 150 mM NaCl)

  • Cell disruption:

    • Resuspend in lysis buffer (50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 1 mM EDTA, protease inhibitors)

    • Sonicate on ice (6 × 30s bursts, 30s cooling intervals)

    • Alternative: grinding with liquid nitrogen for improved membrane protein extraction

  • Membrane fraction isolation:

    • Remove cell debris by centrifugation (10,000 × g, 20 min, 4°C)

    • Ultracentrifuge supernatant (120,000 × g, 1 h, 4°C) to pellet membranes

    • Resuspend membrane pellet in solubilization buffer containing appropriate detergent

  • Protein purification:

    • For His-tagged constructs: Ni-NTA affinity chromatography using detergent-containing buffers

    • Wash with increasing imidazole concentrations (10-40 mM)

    • Elute with 250 mM imidazole

    • Perform size exclusion chromatography for final purification

This isolation procedure typically yields 0.5-2 mg of purified nuoK2 protein per liter of culture, depending on expression conditions and strain optimization.

What PCR-based methods are recommended for cloning the nuoK2 gene?

For cloning the nuoK2 gene from S. coelicolor, the following PCR-based approach is recommended:

  • Primer design:

    • Forward primer: Include a restriction site compatible with your expression vector (e.g., NdeI), followed by the start codon and 18-25 nucleotides of the nuoK2 sequence

    • Reverse primer: Include a compatible restriction site (e.g., HindIII or XhoI), optional His-tag coding sequence, stop codon, and 18-25 nucleotides of the nuoK2 sequence

    • Account for S. coelicolor's high GC content (~72%) when calculating annealing temperatures

  • PCR conditions for GC-rich templates:

    • Use a high-fidelity polymerase suitable for GC-rich templates (e.g., Q5 High-Fidelity DNA Polymerase or Phusion)

    • Include DMSO (5-10%) or specialized GC enhancer solutions

    • Initial denaturation: 98°C for 3 minutes

    • 30 cycles: 98°C for 10s, 62-68°C for 30s, 72°C for 30s per kb

    • Final extension: 72°C for 5 minutes

  • Alternative cloning approach:

    • The PCR targeting method, as described in the development of S. coelicolor mutant strains, can be adapted for nuoK2 cloning with high efficiency

  • Vector selection:

    • For expression in S. coelicolor: pIJ86 (ermE* constitutive promoter) or pIJ8600 (thiostrepton-inducible tipA promoter)

    • For E. coli expression: pET series vectors with appropriate fusion tags to assist membrane protein solubility

What protein expression systems are most effective for recombinant nuoK2?

For optimal expression of recombinant nuoK2, consider these expression systems:

  • Homologous expression in S. coelicolor:

    • Advantages: Native cellular environment, proper membrane insertion, correct folding

    • Recommended strain: M1152 superhost (Δact Δred Δcpk Δcda rpoB[C1298T] rpsL[A262G C271T])

    • Vectors: pIJ86 (constitutive) or pIJ8600 (inducible)

    • Yield: Typically 1-3 mg/L culture

  • Heterologous expression in E. coli:

    • Advantages: Rapid growth, high yields, established protocols

    • Recommended strain: C41(DE3) or C43(DE3) (specialized for membrane proteins)

    • Vectors: pET28a with N-terminal His-tag and fusion partners (MBP or SUMO)

    • Growth temperature: Reduce to 16-20°C after induction

    • Yield: Generally 3-5 mg/L culture but often forms inclusion bodies

  • Cell-free expression system:

    • Advantages: Avoids toxicity issues, direct incorporation into nanodiscs or liposomes

    • System: E. coli S30 extract supplemented with liposomes or nanodiscs

    • Yield: 0.5-1 mg/mL reaction mixture

The choice of expression system should be guided by the specific experimental requirements, particularly considering the membrane-associated nature of nuoK2 and the need for proper folding and integration into membrane structures.

How does nuoK2 contribute to respiratory chain function in S. coelicolor?

The nuoK2 subunit likely provides functional flexibility to the respiratory chain of S. coelicolor. While the primary nuoK participates in the standard NADH:quinone oxidoreductase activity, nuoK2 may serve specialized functions:

  • Developmental adaptation: Expression changes during aerial mycelium formation suggest nuoK2 may optimize respiratory chain function during this transition to nutrient-limited conditions .

  • Substrate specificity: nuoK2 may alter the quinone-binding properties of the complex, potentially allowing interaction with alternative quinones produced under specific conditions.

  • Proton translocation efficiency: As part of the membrane domain of Complex I, variations in the K subunit could influence proton pumping efficiency, allowing metabolic adaptation to environmental stresses.

  • Supercomplex formation: nuoK2 might facilitate interaction with other respiratory complexes (such as the cytochrome bcc-aa3 oxidase supercomplex mentioned in the search results) .

The developmental regulation of oxidative phosphorylation components, including NADH dehydrogenase subunits, appears to be coordinated by regulators such as WhiI, which influences gene expression during spore formation in S. coelicolor .

What spectroscopic methods are most informative for studying nuoK2 function?

For detailed functional analysis of nuoK2, the following spectroscopic approaches are most informative:

  • NADH oxidation kinetics:

    • UV-Vis spectroscopy monitoring NADH oxidation at 340 nm

    • Compare activity of complexes with nuoK vs. nuoK2

    • Assay conditions: 50 mM potassium phosphate buffer (pH 7.5), 100 μM NADH, 100 μM ubiquinone-1

    • Parameters to determine: Km, Vmax, response to different quinone substrates

  • EPR (Electron Paramagnetic Resonance) spectroscopy:

    • Provides information about iron-sulfur clusters and their reduction states

    • Sample preparation: Purified complex frozen in liquid nitrogen

    • Typical settings: Temperature 10-40K, microwave power 1-10 mW

    • Data interpretation: Compare signal intensities and g-values between complexes containing nuoK vs. nuoK2

  • FTIR (Fourier Transform Infrared) difference spectroscopy:

    • Monitors conformational changes during catalysis

    • Electrochemically induced FTIR difference spectra

    • Focus on the 1800-1400 cm^-1 region for protein structural changes

    • Useful for detecting subtle differences in proton pumping mechanism

  • Reconstitution studies in proteoliposomes:

    • Measure proton translocation using pH-sensitive fluorescent dyes

    • Determine H+/e- ratio to assess coupling efficiency

    • Compare complexes with nuoK vs. nuoK2 under various conditions

These approaches provide complementary information about the functional properties of nuoK2 compared to the standard nuoK subunit.

What computational approaches can predict nuoK2 structure-function relationships?

Several computational approaches can provide insights into nuoK2 structure-function relationships:

  • Homology modeling:

    • Template selection: Use bacterial Complex I structures (e.g., Thermus thermophilus, E. coli)

    • Modeling platforms: SWISS-MODEL, I-TASSER, or AlphaFold2

    • Validation: PROCHECK, VERIFY3D for structural quality assessment

    • Focus on: Transmembrane regions, quinone-binding residues, subunit interfaces

  • Molecular dynamics simulations:

    • Embed modeled nuoK2 in a phospholipid bilayer

    • Force fields: CHARMM36 for membrane proteins

    • Simulation length: Minimum 100-200 ns for stable conformations

    • Analysis: Protein stability, lipid interactions, water/ion channels

  • Sequence-based analyses:

    • Multiple sequence alignment of nuoK homologs across actinobacteria

    • Conservation scoring to identify functionally important residues

    • Coevolution analysis to detect residue coupling networks

    • Prediction of post-translational modification sites

  • Integrated systems biology approach:

    • Analyze coexpression networks to identify functional partners

    • Metabolic flux analysis to predict impact on cellular energetics

    • Integration with transcriptomic data from developmental studies

These computational approaches can guide experimental design by identifying key residues for mutagenesis and suggesting potential functional differences between nuoK and nuoK2.

How can nuoK2 be used to optimize heterologous protein expression in S. coelicolor?

Leveraging nuoK2 for optimized heterologous protein expression in S. coelicolor involves several strategic approaches:

  • Metabolic engineering using nuoK2 regulation:

    • Replace native nuoK with nuoK2 in expression strains to alter energy metabolism

    • Co-express nuoK2 under strong promoters to enhance ATP production

    • Create chimeric respiratory complexes with nuoK2 domains to fine-tune energy yield

  • Expression timing optimization:

    • Link heterologous gene expression to nuoK2 regulatory elements

    • Design expression systems that activate during the metabolic shift associated with nuoK2 upregulation

    • Utilize the developmental regulation patterns observed in WhiI-influenced genes

  • Strain development:

    • Generate nuoK2-optimized superhost strains beyond the existing M1146/M1152 platforms

    • Create strains with modified electron transport chains incorporating nuoK2 properties

    • Develop expression hosts with enhanced ATP production suitable for high-yield protein synthesis

  • Anticipated performance improvements:

    • 30-50% increase in target protein yield

    • Improved growth under production conditions

    • Better scaling in bioreactor settings

This approach takes advantage of S. coelicolor's natural adaptations to changing metabolic demands during development, potentially creating more robust expression systems.

What is the relationship between nuoK2 expression and secondary metabolite production in S. coelicolor?

The relationship between nuoK2 expression and secondary metabolite production in S. coelicolor reveals important metabolic interconnections:

  • Metabolic shifts and resource allocation:

    • NADH dehydrogenase components (including nuoK2) show altered expression during aerial development, coinciding with activation of secondary metabolite gene clusters

    • Reduced expression of primary NADH dehydrogenase subunits during development suggests a metabolic shift from oxidative phosphorylation toward alternative energy-generating pathways

  • Developmental coordination:

    • WhiI regulatory network influences both respiratory chain components and certain secondary metabolite pathways

    • Actinorhodin (blue pigment) and undecylprodigiosin (red pigment) production coincides with developmental transitions when respiratory chain composition is changing

  • Energy-metabolism connection:

    • Altered proton gradient efficiency due to nuoK2 incorporation may trigger secondary metabolite production

    • NADH/NAD+ ratio fluctuations resulting from nuoK2 activity could serve as metabolic signals for antibiotic production

  • Experimental evidence:

    • In superhost strains with deleted secondary metabolite clusters (M1146, M1152), resource allocation is shifted away from these pathways

    • WhiI mutant strains show coordinated changes in both respiratory components and pigmented secondary metabolite production

This relationship suggests that engineering nuoK2 expression could provide a novel approach to manipulating secondary metabolite production in Streptomyces species.

How does nuoK2 function differ under various oxygen limitation conditions?

The function of nuoK2 under various oxygen limitation conditions reveals important adaptations in S. coelicolor's respiratory flexibility:

  • Oxygen-dependent expression patterns:

    • Under full aerobic conditions: Standard nuoK predominates

    • Under microaerobic conditions: nuoK2 expression increases

    • Under oxygen-limited conditions: nuoK2 may facilitate altered electron flow through the respiratory chain

  • Functional adaptations:

    • Altered quinone specificity: nuoK2 may show preferential interaction with alternative quinones that predominate under oxygen limitation

    • Modified proton pumping efficiency: nuoK2-containing complexes may maintain ATP synthesis with lower oxygen availability

    • Potential interaction with terminal oxidases: nuoK2 may facilitate electron flow to high-affinity terminal oxidases used under oxygen limitation

  • Experimental approach for studying oxygen-dependent function:

    Oxygen LevelCulture MethodAnalysis TechniqueExpected nuoK2 Response
    21% O₂Standard flaskRNA-seq, proteomicsBaseline expression
    5-10% O₂Controlled bioreactorMembrane proteomicsModerate upregulation
    1-2% O₂Sealed chamber cultureActivity assays, EPRSignificant upregulation
    <1% O₂Anaerobic chamber with limited O₂Metabolic flux analysisMaximum expression
  • Adaptive significance:

    • As an obligate aerobe, S. coelicolor must optimize energy generation across a range of oxygen concentrations in soil microenvironments

    • The nuoK2 variant may represent an adaptation to maintain energy production during transitions between microenvironments with different oxygen availabilities

This oxygen-responsive behavior may be particularly relevant during the developmental transition to aerial growth, when hyphae experience changing oxygen gradients.

What are common challenges in recombinant nuoK2 expression and how can they be addressed?

Common challenges in recombinant nuoK2 expression and their solutions include:

  • Low expression levels:

    • Challenge: Membrane proteins often express poorly

    • Solution: Use specialized strains (C41/C43 for E. coli, M1152 for S. coelicolor)

    • Solution: Lower induction temperature (16-20°C)

    • Solution: Add membrane-stabilizing additives (glycerol 5-10%)

  • Protein misfolding and aggregation:

    • Challenge: Inclusion body formation

    • Solution: Express with fusion partners (MBP, SUMO)

    • Solution: Co-express with chaperones (GroEL/ES)

    • Solution: Use mild detergents during extraction (DDM, LMNG)

  • Protein instability:

    • Challenge: Rapid degradation after extraction

    • Solution: Include protease inhibitor cocktail

    • Solution: Maintain samples at 4°C throughout purification

    • Solution: Add stabilizing ligands during purification

    • Solution: Consider nanodiscs or amphipols for final storage

  • Poor membrane integration:

    • Challenge: Improper insertion into membranes

    • Solution: Use cell-free systems with liposomes

    • Solution: Express in homologous host (S. coelicolor)

    • Solution: Optimize signal sequences if applicable

  • Difficult detection:

    • Challenge: Low abundance membrane proteins are hard to detect

    • Solution: Use specific antibodies against nuoK2 or epitope tags

    • Solution: Incorporate fluorescent protein fusions for localization studies

    • Solution: Use mass spectrometry for sensitive detection

These approaches can be combined as needed to optimize recombinant nuoK2 expression based on specific experimental requirements.

How can researchers differentiate between nuoK and nuoK2 in experimental analyses?

Differentiating between nuoK and nuoK2 in experimental analyses requires specific approaches targeting their unique features:

  • Sequence-specific detection:

    • PCR primers targeting unique regions (3' end often most divergent)

    • Custom antibodies raised against unique peptide sequences

    • RNA probes for northern blotting or in situ hybridization

  • Expression pattern analysis:

    • RT-qPCR with isoform-specific primers to quantify relative expression

    • RNA-seq data analysis focusing on uniquely mapping reads

    • Developmental time-course studies comparing expression patterns

  • Protein-level differentiation:

    • 2D gel electrophoresis to separate based on both size and charge differences

    • Mass spectrometry targeting unique peptides:

      ApproachResolutionSample RequirementsAdvantages
      Shotgun proteomicsModerate10-100 μg total membrane proteinGood for global analysis
      Targeted SRM/MRMHigh1-10 μg membrane proteinQuantitative, sensitive
      Top-down proteomicsHighest1-5 μg purified proteinComplete protein analysis
  • Functional differentiation:

    • Generate specific knockout strains for each variant

    • Complementation experiments with each variant

    • Activity assays under different conditions to reveal functional specialization

    • Inducible expression systems to analyze effects of each variant independently

These approaches provide complementary information and can be combined for comprehensive differentiation between the two variants.

What advanced analytical techniques help resolve contradictory data about nuoK2 function?

When facing contradictory data about nuoK2 function, these advanced analytical approaches can help resolve discrepancies:

  • Integrative multi-omics approach:

    • Combined transcriptomics, proteomics, and metabolomics data

    • Correlation analysis across multiple conditions

    • Network modeling to contextualize contradictory observations

    • Example workflow: RNA-seq → membrane proteomics → metabolic flux analysis → network integration

  • Single-cell techniques:

    • Single-cell RNA-seq to detect cellular heterogeneity

    • Fluorescent reporters for real-time expression monitoring

    • Single-molecule localization microscopy for spatial organization

    • These approaches can reveal if contradictions stem from population heterogeneity

  • In vivo crosslinking and interaction studies:

    • BioID or APEX2 proximity labeling to identify interaction partners

    • Chemical crosslinking followed by mass spectrometry (XL-MS)

    • Co-immunoprecipitation with different detergents to preserve various interactions

    • These methods can clarify functional context through protein-protein interactions

  • Controlled environmental perturbations:

    • Precise oxygen gradient experiments

    • Nutrient limitation series

    • Temperature and pH variation studies

    • Testing multiple Streptomyces species for evolutionary conservation

  • Systematic variant analysis:

    • Construct chimeric proteins between nuoK and nuoK2

    • Site-directed mutagenesis of divergent residues

    • Domain swapping experiments

    • These approaches can pinpoint which regions are responsible for functional differences

When applied systematically, these techniques can reconcile apparently contradictory observations by revealing condition-specific functions, complex regulatory networks, or methodological limitations in earlier studies.

How might nuoK2 be involved in S. coelicolor's adaptation to environmental stresses?

The potential role of nuoK2 in environmental stress adaptation represents an important frontier in Streptomyces research:

  • Soil microenvironment adaptation:

    • Nutrient fluctuation responses: nuoK2 may optimize energy generation during carbon source shifts

    • Moisture stress: Expression patterns may change during dry-wet cycles typical in soil environments

    • Temperature variation: nuoK2 might provide respiratory flexibility at temperature extremes

  • Competitive interactions:

    • Defense against microbial competitors: Respiratory adjustments during antibiotic production

    • Adaptation to competitor-produced antibiotics: Alternative respiratory pathways when primary routes are inhibited

    • Symbiotic relationships: Optimized energy metabolism during plant root colonization

  • Developmental transitions:

    • Aerial mycelium formation: Evidence from whiI mutant studies suggests respiratory remodeling during this transition

    • Sporulation: Energy conservation mechanisms during spore formation

    • Germination: Rapid energy generation systems during spore outgrowth

  • Proposed experimental approaches:

    • Comparative expression analysis under diverse stresses

    • nuoK2 knockout phenotype assessment under stress conditions

    • In situ expression studies in soil microcosms

    • Competition assays between wild-type and nuoK2 mutants

This research direction would connect molecular-level respiratory chain adaptations to ecological fitness in the complex soil environment.

What emerging technologies will advance nuoK2 research in the next decade?

Emerging technologies poised to transform nuoK2 research in the coming decade include:

  • Structural biology advances:

    • Cryo-EM for membrane protein complexes at near-atomic resolution

    • Integrative structural biology combining multiple techniques

    • Time-resolved structural studies capturing conformational changes

    • In situ structural determination in native-like environments

  • Genome engineering technologies:

    • CRISPR-Cas systems optimized for Streptomyces

    • Base editing for precise genomic modifications

    • Large-scale synthetic biology platforms

    • Multiplexed genome engineering for pathway optimization

  • Advanced imaging techniques:

    • Super-resolution microscopy for respiratory complex organization

    • Correlative light and electron microscopy (CLEM)

    • Label-free imaging based on Raman spectroscopy

    • Multicolor live-cell imaging of respiratory dynamics

  • Computational and AI approaches:

    • Deep learning for protein structure prediction

    • Molecular dynamics simulations at extended timescales

    • Metabolic models incorporating respiratory chain variants

    • Systems biology frameworks integrating multi-omics data

  • Single-molecule techniques:

    • Optical tweezers for measuring single-complex forces

    • Nanopore technologies for single-protein analysis

    • Single-molecule FRET for conformational dynamics

    • On-chip microfluidic single-cell analysis

These technologies will enable unprecedented insights into the molecular mechanisms, cellular contexts, and ecological significance of nuoK2 in S. coelicolor.

How can evolutionary analysis of nuoK2 inform our understanding of Streptomyces respiratory chain diversity?

Evolutionary analysis of nuoK2 provides a powerful framework for understanding respiratory chain diversity across Streptomyces species:

  • Comparative genomics approach:

    • Survey nuoK duplications across Actinobacteria

    • Analyze selection pressures on nuoK vs. nuoK2 sequences

    • Identify co-evolving residues within respiratory complexes

    • Map duplication events onto Streptomyces phylogeny

  • Correlation with ecological niches:

    • Associate nuoK2 variants with habitat characteristics

    • Compare soil-dwelling vs. marine Streptomyces species

    • Analyze extremophile Streptomyces for respiratory adaptations

    • Correlate with geographical distribution patterns

  • Functional divergence analysis:

    • Reconstruct ancestral sequences to identify key mutations

    • Heterologous expression of nuoK2 variants from different species

    • Compare biochemical properties across evolutionary distance

    • Identify convergent evolution in respiratory chain components

  • Proposed analytical framework:

    Analysis LevelMethodsExpected Insights
    SequenceMaximum likelihood phylogeny, selection analysis (dN/dS)Evolutionary history, selection pressures
    StructureHomology modeling, molecular dynamicsStructural adaptations, functional sites
    FunctionHeterologous expression, biochemical assaysPerformance differences, specialization
    SystemsMetabolic modeling, flux analysisEcosystem adaptations, energy efficiency

This evolutionary perspective can reveal how respiratory chain diversity contributed to the remarkable ecological success and metabolic versatility of Streptomyces species across diverse environments.

How can nuoK2 research inform strategies for enhancing secondary metabolite production?

Integrating nuoK2 research into secondary metabolite production strategies offers several promising approaches:

  • Metabolic engineering based on respiratory chain modifications:

    • Overexpression of nuoK2 to alter redox balance

    • Creation of strains with optimized respiratory chains for precursor supply

    • Engineering electron flux toward NADPH generation for polyketide and non-ribosomal peptide synthesis

    • Coordinated expression of nuoK2 with secondary metabolite biosynthetic gene clusters

  • Developmental timing optimization:

    • Synchronize nuoK2-based respiratory adaptation with secondary metabolite production

    • Leverage the developmental regulation patterns observed in WhiI-influenced pathways

    • Create regulatory circuits linking respiratory chain composition to antibiotic production

  • Stress response integration:

    • Utilize nuoK2's potential role in stress adaptation to trigger secondary metabolism

    • Design fermentation strategies incorporating controlled stress conditions

    • Develop reporter systems based on nuoK2 promoters to monitor metabolic state

  • Expected improvements:

    • 30-80% increased yields of target compounds

    • More consistent production across fermentation batches

    • Reduced oxygen demand during high-productivity phases

    • Improved precursor supply for complex secondary metabolites

This integrated approach recognizes the fundamental connection between primary metabolism (respiratory chain) and secondary metabolism (antibiotic production) in Streptomyces species.

What interdisciplinary approaches combine nuoK2 research with systems biology?

Interdisciplinary approaches integrating nuoK2 research with systems biology create powerful frameworks for understanding S. coelicolor metabolism:

  • Multi-level data integration:

    • Genome-scale metabolic models incorporating nuoK2 variants

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Flux balance analysis with respiratory chain constraints

    • Agent-based modeling of cellular heterogeneity in Streptomyces colonies

  • Network analysis approaches:

    • Regulatory network reconstruction around respiratory components

    • Identification of key metabolic nodes connected to nuoK2 function

    • Correlation networks linking respiratory chain to secondary metabolism

    • Perturbation analysis to identify system robustness properties

  • Temporal dynamics modeling:

    • Dynamic models of respiratory chain composition during development

    • Incorporation of developmental regulators like WhiI

    • Stochastic modeling of gene expression variability

    • Multi-scale modeling connecting molecular events to colony morphology

  • Collaboration framework:

    • Bioinformatics: Sequence and structure analysis, evolutionary studies

    • Biochemistry: Protein characterization, interaction studies

    • Microbiology: Growth studies, phenotypic analysis

    • Systems biology: Model development, data integration

    • Synthetic biology: Pathway engineering, chassis optimization

This systems-level understanding can transform our view of Streptomyces metabolism from isolated pathways to an integrated network responding to developmental and environmental cues.

How does nuoK2 research contribute to our understanding of bacterial development and differentiation?

The study of nuoK2 provides valuable insights into the broader understanding of bacterial development and differentiation:

  • Metabolic underpinnings of morphological development:

    • Respiratory chain remodeling during aerial hyphae formation

    • Energy generation strategies during the transition to nutrient-limited conditions

    • Metabolic signals triggering developmental programs

    • Connection between WhiI-regulated genes and respiratory chain components

  • Cellular differentiation mechanisms:

    • Compartmentalization of metabolism during Streptomyces development

    • Respiratory chain specialization in different cell types

    • Energy homeostasis during sporulation

    • Metabolic adaptation during the life cycle

  • Evolutionary perspectives:

    • Comparison with developmental systems in other bacteria

    • Parallel evolution of respiratory adaptations during development

    • Conservation of metabolic shifts during differentiation across bacterial phyla

    • Evolutionary origin of developmental regulators controlling respiratory genes

  • Conceptual advances:

    • Recognition of respiratory chain composition as both a consequence and driver of development

    • Understanding bacterial differentiation as a coordinated metabolic and morphological process

    • Appreciation of the role of energy metabolism in developmental timing

    • Integration of primary metabolism into developmental biology models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.