Recombinant Streptomyces coelicolor Probable Cytochrome c Oxidase Subunit 2 (ctaC) is a protein derived from the bacterium Streptomyces coelicolor, a model organism known for its ability to produce antibiotics and other secondary metabolites. This protein is part of the cytochrome c oxidase complex, which plays a crucial role in the bacterial respiratory chain. The recombinant version of this protein is expressed in Escherichia coli and is often used in research for studying respiratory processes and protein function.
The recombinant ctaC protein is a full-length mature protein, spanning amino acids 34 to 319, and is fused with an N-terminal His tag to facilitate purification and detection. It is available in a lyophilized powder form and has a purity of greater than 90% as determined by SDS-PAGE .
Species: Streptomyces coelicolor
Source: Expressed in E. coli
Tag: His-tagged
Protein Length: Full-length mature protein (34-319 amino acids)
Form: Lyophilized powder
Purity: Greater than 90%
Storage: Store at -20°C/-80°C; avoid repeated freeze-thaw cycles
The amino acid sequence of the recombinant ctaC protein is crucial for understanding its structure and function. The sequence includes key motifs and domains that are essential for its role in the cytochrome c oxidase complex.
| Amino Acid Sequence |
|---|
| CTYEDFPRLGMPTPTTEEAPRILSLWQGSWAAALATGVLVWGLILWSVFFHRRSRTKVEV PPQTRYNLPIEALYTMVPLVIVSVLFYFTARDESDLMSLNKKPDLTVNVVGFQWSWCFNH IEDVPGSTGDAKTSKELAGIPDRFIEDFPANAGGVYDCGTPGTENPQTGNPGPTLWLPKG KTVRFVLTSRDVIHSFWVVPFLMKQDVIPGHTNAFEVTPNKEGTFLGKCAELCGVDHSRM LFNVKVVSPERYEQHLQDLAKKGQTGYVPAGIAQTSHEKNRETNNL |
In Streptomyces coelicolor, the cytochrome c oxidase complex, which includes the ctaC subunit, is essential for aerobic respiration. Unlike some other bacteria, S. coelicolor lacks a soluble cytochrome c in its respiratory chain, instead using a membrane-associated diheme c-type cytochrome, QcrC, to facilitate electron transfer between the cytochrome bcc and aa3 oxidase complexes .
Recombinant ctaC protein is used in various research applications, including studies on respiratory complexes and protein-protein interactions. It can be used to investigate the assembly and function of the cytochrome c oxidase complex in bacteria.
| Feature | Streptomyces coelicolor ctaC | Mycobacterium leprae ctaC |
|---|---|---|
| UniProt ID | Q9X814 | Q9CCF1 |
| Amino Acid Sequence | Specific to S. coelicolor | Specific to M. leprae |
| Expression Host | E. coli | E. coli |
| Purity | >90% | >90% |
| Storage Conditions | -20°C/-80°C | -20°C/-80°C |
KEGG: sco:SCO2156
STRING: 100226.SCO2156
Based on homology with other bacterial species, S. coelicolor ctaC likely functions as subunit II of cytochrome c oxidase, a terminal enzyme in the respiratory electron transport chain. This subunit typically contains a copper center (CuA) that serves as the primary electron acceptor from cytochrome c. In Bacillus subtilis, ctaC is part of cytochrome caa3, a specific type of cytochrome c oxidase . While the exact function in S. coelicolor requires experimental validation, its role is presumably similar, facilitating electron transfer in aerobic respiration, which is critical for energy production during various growth phases and morphological differentiation in this filamentous bacterium.
Evidence from B. subtilis indicates that ctaC undergoes significant post-translational processing, specifically functioning as a lipoprotein with lipid modification at its N-terminus . In B. subtilis, the ctaC precursor contains features typical of bacterial lipoproteins, including a signal peptide that is cleaved by signal peptidase type II (Lsp) . Interestingly, while removal of the signal peptide from the CtaC polypeptide is required for formation of functional enzyme, the lipid modification itself appears less critical for function . For S. coelicolor ctaC, researchers should investigate whether similar post-translational processing occurs by analyzing the N-terminal sequence for lipoprotein signatures and conducting mutagenesis studies of predicted processing sites.
While direct evidence linking ctaC expression to antibiotic production in S. coelicolor is limited, several studies have demonstrated connections between respiratory metabolism and secondary metabolite biosynthesis in Streptomyces species. Similar proteins in S. coelicolor, such as TrpM (which modulates L-tryptophan biosynthesis), have been shown to significantly impact antibiotic production, particularly affecting actinorhodin (ACT) and calcium-dependent antibiotic (CDA) levels . Given that cytochrome c oxidase activity affects cellular energy status and redox balance, ctaC likely influences antibiotic production indirectly through its effects on primary metabolism and energy generation. Researchers should consider measuring antibiotic production in ctaC mutants under various growth conditions to establish direct correlations.
For expressing recombinant S. coelicolor ctaC, researchers should consider several factors in selecting an expression system:
| Expression System | Advantages | Disadvantages | Recommendations |
|---|---|---|---|
| E. coli (C41/C43) | Fast growth, high yields, well-established protocols | May lack proper machinery for post-translational modifications | Optimal for initial structural studies |
| Streptomyces lividans | Native post-translational modifications, proper membrane insertion | Slower growth, lower yields | Preferred for functional studies |
| Pichia pastoris | Eukaryotic processing, high density cultures | Glycosylation patterns may differ | Alternative for difficult-to-express constructs |
If S. coelicolor ctaC is indeed a lipoprotein like its B. subtilis counterpart , careful consideration must be given to the host's ability to perform the necessary post-translational modifications. Expression in a Streptomyces host might be preferable for obtaining properly processed protein for functional studies.
Purification of membrane proteins like ctaC requires specialized approaches:
Membrane preparation: Cells should be disrupted by mechanical methods (French press or sonication) in buffer containing protease inhibitors, followed by differential centrifugation to isolate membrane fractions.
Solubilization: Screen multiple detergents (DDM, LMNG, digitonin) at various concentrations to optimize extraction while maintaining native structure. For ctaC specifically, consider that if it's a lipoprotein similar to B. subtilis ctaC , detergent selection is particularly critical to maintain lipid interactions.
Affinity chromatography: Utilize an engineered affinity tag (6xHis or Strep-tag) positioned to avoid interference with the copper-binding region or membrane topology. For ctaC from B. subtilis, immunoblot analysis has been effective in detecting both processed and unprocessed forms , suggesting similar approaches may work for S. coelicolor ctaC.
Size exclusion chromatography: A final polishing step to ensure homogeneity and remove aggregates, preferably in a buffer containing a mild detergent at concentrations just above the critical micelle concentration.
The purification buffer should be optimized to maintain the copper center, potentially including stabilizing agents such as glycerol (10-15%) and specific lipids to maintain native-like environment.
Verification of structural integrity should employ multiple complementary approaches:
Spectroscopic analysis: UV-visible absorption spectroscopy to monitor the copper center, characteristic peaks around 480-500 nm indicating properly folded CuA site.
Metal content analysis: ICP-MS to quantify copper incorporation, with expected stoichiometry of two copper ions per ctaC molecule.
Circular dichroism: To assess secondary structure content, particularly important if comparing wild-type and mutant proteins.
Functional assays: Electron transfer activity from reduced cytochrome c can be monitored spectrophotometrically, providing a direct measure of functional integrity.
Mass spectrometry: To verify post-translational modifications, particularly if S. coelicolor ctaC undergoes lipid modification similar to B. subtilis ctaC .
For B. subtilis CtaC, radioactive labeling has been used to demonstrate that the polypeptide contains covalently bound heme, with the cytochrome c domain assembled and located on the outer side of the membrane . Similar approaches could be applied to S. coelicolor ctaC.
Several complementary approaches can elucidate these interactions:
Co-expression and co-purification: Expression of ctaC along with other subunits of the cytochrome c oxidase complex can reveal stable interactions and potentially facilitate purification of the entire complex.
Cross-linking coupled with mass spectrometry: Chemical cross-linkers of various spacer lengths can capture transient interactions, with subsequent mass spectrometry identification of cross-linked peptides to map interaction interfaces.
Surface plasmon resonance (SPR): For quantitative analysis of binding kinetics between purified components, providing association and dissociation rate constants.
Cryo-electron microscopy: For structural characterization of the entire complex, revealing the spatial arrangement of ctaC relative to other subunits.
Genetic approaches: Bacterial two-hybrid systems similar to those used to demonstrate TrpM-PepA interactions in S. coelicolor could be adapted to study ctaC interactions.
In B. subtilis, analysis of mutants blocked in prolipoprotein diacylglyceryl transferase (Lgt) or signal peptidase type II (Lsp) has provided insights into ctaC processing requirements , suggesting similar genetic approaches could be valuable for studying S. coelicolor ctaC.
Copper incorporation is essential for ctaC function as it forms the CuA center involved in electron transfer. Research approaches should include:
Metal-substitution studies: Replacing copper with other metals (zinc, mercury) to assess specific roles of copper in electron transfer.
Site-directed mutagenesis: Targeting conserved copper-binding residues (typically histidine and cysteine) to assess their contribution to metal coordination and catalytic function.
Spectroscopic characterization: EPR spectroscopy to characterize the electronic structure of the copper center in different oxidation states.
Copper incorporation efficiency: Comparing protein expressed under copper-supplemented versus copper-limited conditions to determine the relationship between copper incorporation and functional activity.
Copper chaperone identification: Investigating whether specific chaperones assist in copper incorporation into ctaC, as observed in other bacterial systems.
If S. coelicolor ctaC functions similarly to B. subtilis ctaC, researchers should also consider how post-translational processing might affect copper center formation, as studies in B. subtilis showed that signal peptide removal impacts enzyme activity .
Understanding conformational changes during catalysis requires specialized techniques:
Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify regions undergoing conformational changes during catalysis by monitoring the rate of hydrogen exchange.
Time-resolved spectroscopy: To capture transient intermediates during electron transfer, potentially revealing rate-limiting steps.
Single-molecule FRET: By introducing fluorescent labels at strategic positions, conformational changes can be monitored in real-time at the single-molecule level.
Molecular dynamics simulations: Computational approaches to model conformational changes, particularly useful when integrated with experimental constraints.
Electron paramagnetic resonance (EPR) with site-directed spin labeling: To monitor distances between specific residues during different stages of the catalytic cycle.
These approaches would complement functional studies and provide mechanistic insights into how electron transfer is coupled to proton translocation in the cytochrome c oxidase complex.
Several genetic approaches can provide insights into ctaC function:
Gene knockout/knockdown: Complete deletion or conditional repression of ctaC to assess its essentiality and impact on growth and antibiotic production.
Site-directed mutagenesis: Introduction of specific mutations to study the role of key residues in function, particularly those involved in copper binding or interaction with other subunits.
Reporter gene fusions: Constructing transcriptional or translational fusions to monitor expression patterns under different growth conditions.
Complementation studies: Reintroduction of wild-type or mutant ctaC genes into a knockout background to verify phenotypic effects and study structure-function relationships.
Heterologous expression: Similar to the approach used for trpM in S. coelicolor, where a knock-in mutant was generated by cloning the gene into an overexpressing vector , overexpression of ctaC could provide insights into its role in respiratory metabolism and potentially antibiotic production.
As a component of cytochrome c oxidase, which facilitates aerobic respiration, ctaC expression and function likely respond to oxygen availability:
In S. coelicolor, complex regulatory networks control morphological differentiation and antibiotic production in response to environmental conditions , suggesting ctaC expression may similarly be regulated as part of the adaptive response to oxygen availability.
S. coelicolor undergoes complex morphological differentiation, including aerial hyphae formation and sporulation, which is associated with changes in metabolic activity:
Microscopic analysis: Comparing development of aerial hyphae and spore formation in wild-type versus ctaC mutant strains.
Stage-specific expression: Analyzing ctaC expression levels during different developmental stages using time-course studies.
Complementation with homologs: Testing whether ctaC homologs from other bacteria (e.g., B. subtilis) can restore normal development in S. coelicolor ctaC mutants.
Interaction studies: Investigating potential interactions between ctaC and known regulators of morphological differentiation, similar to studies of TrpM interaction with PepA, which plays a role in antibiotic production and sporulation .
Metabolic flux analysis: Quantifying changes in carbon flux through central metabolic pathways during morphological differentiation in wild-type versus ctaC mutant strains.
Studies in S. coelicolor have shown that proteins like TrpM influence both antibiotic production and morphological differentiation , suggesting respiratory proteins like ctaC may similarly impact these interconnected processes.
Comparative analysis provides evolutionary and functional insights:
Researchers should perform detailed sequence alignments focusing on conserved functional domains, particularly the copper-binding regions and cytochrome c interaction sites. Homology modeling based on crystal structures from well-characterized homologs can provide structural insights pending experimental structure determination.
Streptomyces species inhabit diverse ecological niches and exhibit varying metabolic capabilities:
Genomic analysis: Comparing ctaC gene sequences and genomic context across multiple Streptomyces species to identify conserved and variable regions.
Expression patterns: Analyzing whether ctaC expression is regulated similarly across species in response to environmental factors.
Terminal oxidase diversity: Identifying species with multiple terminal oxidases versus those relying primarily on cytochrome c oxidase, correlating with ecological adaptations.
Horizontal gene transfer assessment: Investigating whether respiratory chain components show evidence of horizontal acquisition in certain lineages.
Correlation with metabolic capabilities: Examining whether species producing specific classes of antibiotics show differences in respiratory chain composition or regulation.
Studies on the recently identified nucleoid-associated protein-like ccr1 in S. coelicolor and S. nigrescens have shown that this protein affects secondary metabolite production in both species , suggesting that comparative approaches can reveal conserved regulatory mechanisms affecting metabolism.
Evolutionary analysis can reveal adaptations to different ecological niches:
Phylogenetic analysis: Constructing phylogenetic trees of ctaC and other cytochrome c oxidase components across actinobacteria to identify evolutionary patterns.
Selection pressure analysis: Calculating dN/dS ratios to identify regions under purifying or diversifying selection.
Correlation with genome size: Investigating whether complex respiratory systems correlate with larger genome sizes and more diverse metabolic capabilities.
Oxygen affinity differences: Comparing kinetic properties of cytochrome c oxidases from actinobacteria adapted to different oxygen tensions.
Co-evolution with electron donors: Examining whether cytochrome c oxidase components have co-evolved with upstream components of the respiratory chain.
The high conservation of certain proteins across Streptomyces species, as observed with the ccr1 homolog found in 96.4% of Streptomyces species examined , suggests that core metabolic functions may be strongly conserved despite diversity in secondary metabolism.
Membrane proteins like ctaC often present solubility and stability challenges:
Detergent screening: Systematic evaluation of detergent types (nonionic, zwitterionic, steroid-based) and concentrations to identify optimal solubilization conditions.
Fusion partners: N- or C-terminal fusion with solubility-enhancing partners (e.g., MBP, SUMO) that can be later removed by specific proteases.
Nanodiscs or amphipols: Reconstitution into these membrane mimetics can enhance stability compared to detergent micelles.
Buffer optimization: Systematic screening of pH, ionic strength, and specific ions (particularly copper) to identify stabilizing conditions.
Co-expression with interaction partners: Expression alongside other subunits of the cytochrome c oxidase complex may enhance stability through formation of native-like complexes.
For B. subtilis ctaC, studies have shown that processing by signal peptidase type II affects enzyme activity , suggesting that proper post-translational processing may be critical for stability and function of S. coelicolor ctaC as well.
Proper copper incorporation is essential for functional ctaC:
Expression media supplementation: Adding copper salts (typically CuSO4) to expression media, with optimization of concentration to avoid toxicity.
Co-expression with copper chaperones: Identifying and co-expressing native S. coelicolor copper chaperones that may facilitate copper incorporation.
Anaerobic purification: Performing protein purification under oxygen-limited conditions to prevent oxidation of copper-binding sites.
In vitro reconstitution: Removing existing metals with chelators followed by controlled addition of copper under optimized conditions.
Site-directed mutagenesis of copper ligands: Creating variants with mutations in copper-coordinating residues as negative controls to verify specific incorporation.
Researchers should also consider monitoring copper incorporation spectroscopically throughout the purification process to identify steps where metal loss might occur.
Activity assays require careful consideration of multiple factors:
Electron donor selection: Using physiologically relevant cytochrome c (preferably from S. coelicolor) rather than commercially available horse heart cytochrome c which may have different interaction properties.
Detergent interference: Many detergents can affect electron transfer kinetics or interact with assay components; systematic testing of detergent type and concentration is essential.
Lipid requirements: Identifying specific lipids that may be required for optimal activity, potentially through activity restoration experiments with defined lipid mixtures.
Reagent quality: Ensuring high-quality, fully reduced cytochrome c for consistent results, typically by treatment with excess ascorbate followed by desalting.
Buffer composition: Optimizing ionic strength and specific ion concentrations, particularly for divalent cations that might influence protein-protein interactions.
Studies with B. subtilis ctaC have shown that mutations in prolipoprotein processing affect cytochrome caa3 enzyme activity , highlighting the importance of proper post-translational processing for functional assays of S. coelicolor ctaC as well.
Advanced structural biology approaches offer significant potential:
Cryo-electron microscopy: Particularly suitable for membrane protein complexes, potentially revealing the arrangement of ctaC within the complete cytochrome c oxidase complex.
X-ray crystallography: While challenging for membrane proteins, successful crystallization would provide atomic-level resolution of ctaC structure.
Solid-state NMR: Applicable to membrane proteins reconstituted in lipid environments, providing information about dynamics and lipid interactions.
Integrative structural biology: Combining multiple techniques (SAXS, HDX-MS, crosslinking-MS) to construct composite structural models when high-resolution structures prove elusive.
Time-resolved structural methods: Capturing conformational changes during the catalytic cycle using techniques like time-resolved cryo-EM or X-ray free electron laser (XFEL) approaches.
These approaches would build upon the biochemical characterization methods used for B. subtilis ctaC to provide detailed structural insights into S. coelicolor ctaC function.
Emerging genetic technologies offer new experimental possibilities:
CRISPR interference (CRISPRi): For tunable repression of ctaC expression to study partial loss-of-function phenotypes.
Base editing: Precision engineering of specific codons without double-strand breaks, enabling subtle modifications of functionally important residues.
Operon reporter systems: Using fluorescent proteins to monitor co-transcription of ctaC with other genes in the same operon under various conditions.
Global regulatory network mapping: Techniques like ChIP-seq to identify transcription factors controlling ctaC expression.
Single-cell approaches: Microfluidic devices coupled with fluorescent reporters to study cell-to-cell variability in ctaC expression during development.
These approaches could complement the knock-in strategy used to study TrpM function in S. coelicolor , providing more nuanced insights into ctaC regulation and function.
Holistic approaches can place ctaC in broader biological context:
Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from wild-type and ctaC mutant strains to map global consequences of ctaC perturbation.
Flux balance analysis: Computational modeling of metabolic networks to predict how changes in respiratory chain function affect metabolic flux distributions.
Regulatory network inference: Identifying transcriptional and post-transcriptional regulatory mechanisms connecting respiratory chain components to other cellular processes.
Comparative systems biology: Examining how respiratory chain composition and regulation differ across Streptomyces species with diverse metabolic capabilities.
Machine learning approaches: Developing predictive models of how environmental perturbations affect respiratory chain function and consequent metabolic adaptations.
Similar approaches have been used to study the impact of TrpM on S. coelicolor metabolism, revealing effects on protein synthesis, nucleotide metabolism, central carbon metabolism, and amino acid metabolism , suggesting that ctaC perturbation may likewise have complex metabolic consequences.