Recombinant Streptomyces coelicolor Prolipoprotein diacylglyceryl transferase 1 (lgt1)

Shipped with Ice Packs
In Stock

Description

Introduction to Bacterial Lipoprotein Biogenesis

Bacterial lipoproteins constitute a distinct class of membrane proteins that play essential roles in building and maintaining the cell envelope while providing a key interface with the external environment. These proteins are anchored to the bacterial membrane through lipid modifications that occur post-translationally . The biogenesis of bacterial lipoproteins follows a well-conserved pathway across bacterial species, with prolipoprotein diacylglyceryl transferase (Lgt) catalyzing the first critical step in this modification process.

Following translocation across the cytoplasmic membrane, lipoprotein precursors undergo lipidation on a conserved cysteine residue catalyzed by Lgt. This lipidation anchors the proteins to the outer leaflet of the cytoplasmic membrane in Gram-positive bacteria . The signal peptide is subsequently cleaved by lipoprotein signal peptidase (Lsp), leaving the lipid-modified cysteine at the N-terminus of the mature lipoprotein. This process is critical for proper lipoprotein localization and function within the bacterial cell envelope.

Recombinant Production and Characterization

The recombinant production of S. coelicolor Lgt1 has been successfully achieved using E. coli expression systems. The protein has been expressed as a full-length construct (343 amino acids) fused to an N-terminal His-tag, facilitating purification through affinity chromatography . This approach enables detailed structural and functional studies of the enzyme.

Table 1: Specifications of Recombinant Lgt1 Protein Preparation

ParameterSpecification
SpeciesStreptomyces coelicolor
SourceE. coli
TagHis
Protein LengthFull Length (1-343)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C upon receipt; aliquoting necessary for multiple use
ReconstitutionIn deionized sterile water to 0.1-1.0 mg/mL; addition of 5-50% glycerol for long-term storage

The recombinant protein is typically prepared as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE . For functional studies and long-term storage, the protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol . Care must be taken during handling and storage, as repeated freeze-thaw cycles are not recommended, and working aliquots should be stored at 4°C for up to one week .

To verify the functional activity of recombinant Lgt proteins, complementation assays in lgt mutant strains can be employed. Both S. coelicolor Lgt1 and Lgt2 have demonstrated the ability to functionally complement the lgt mutant of S. scabies, confirming their enzymatic activity .

Functional Mechanism and Substrate Recognition

The primary function of Lgt1 in S. coelicolor is to catalyze the transfer of diacylglyceryl moieties from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine residue in the lipobox motif of lipoprotein precursors. This reaction constitutes the first step in the maturation of bacterial lipoproteins, enabling their proper anchoring to the cytoplasmic membrane.

Lgt1 recognizes lipoprotein precursors containing a characteristic lipobox motif, typically L₍₋₃₎-A/S₍₋₂₎-G/A₍₋₁₎-C₍₊₁₎, relative to the cleavage site . This highly conserved sequence serves as the recognition motif for the enzyme and determines the site of lipid modification. Following lipidation by Lgt1, the signal peptide is cleaved by lipoprotein signal peptidase (Lsp), leaving the lipid-modified cysteine at the N-terminus of the mature lipoprotein .

Research on lipoprotein signal peptidase (Lsp) in S. coelicolor has shown that deleting this gene results in growth and developmental defects that cannot be restored by reintroducing lsp . This suggests complex interactions within the lipoprotein biogenesis pathway and potentially indicates the essentiality of proper lipoprotein processing in this organism.

The mechanism by which Lgt recognizes and distinguishes its lipoprotein substrates from other secreted proteins is not fully elucidated, but the lipobox motif appears to be the primary determinant. Additionally, the unique feature of S. coelicolor using both Sec and Tat pathways for lipoprotein translocation adds another layer of complexity to understanding substrate recognition by Lgt1 and Lgt2 in this organism .

Biological Significance and Essentiality

The biological significance of Lgt1 in S. coelicolor is highlighted by several unique aspects of lipoprotein biogenesis in this organism compared to other bacteria. Most notably, while the lipoprotein biosynthesis pathway is non-essential in all other Gram-positive bacteria tested to date, evidence suggests it might be essential in S. coelicolor . This essential nature underscores the critical role of lipoproteins in the physiology of this bacterium.

S. coelicolor also stands out for its extensive use of the Tat pathway for lipoprotein translocation, in contrast to most bacteria which primarily utilize the Sec pathway for this purpose . This unique feature suggests specialized roles for lipoproteins in this organism and potentially distinctive requirements for their modification by Lgt1 and Lgt2.

The lipoproteins processed by Lgt enzymes appear to have diverse functions in S. coelicolor, including roles in solute binding, ABC transport, and critically, cell wall biosynthesis . The latter function may explain why defects in protein modification pathways in Actinobacteria can result in hypersensitivity to cell wall-targeting antibiotics . For example, mutants in genes encoding cell wall-active proteins display hypersensitivity to cell wall-targeting antibiotics and increased susceptibility to lysozyme treatment .

Applications and Future Research Directions

Recombinant Lgt1 from S. coelicolor serves as a valuable tool for studying the mechanisms of bacterial lipoprotein biogenesis. Its successful expression and purification enable detailed biochemical and structural characterization, providing insights into the catalytic mechanism of diacylglyceryl transfer and substrate specificity.

From a fundamental research perspective, Lgt1 offers opportunities to explore several aspects of bacterial physiology:

  1. The potential essentiality of lipoprotein biogenesis in S. coelicolor presents an interesting contrast to other Gram-positive bacteria, where this pathway is typically non-essential.

  2. The unusual feature of S. coelicolor utilizing both Sec and Tat pathways for lipoprotein translocation raises questions about how Lgt1 and Lgt2 recognize and process substrates from these different export pathways.

  3. The functional redundancy between Lgt1 and Lgt2 suggests potential specialization or differential expression patterns that could be explored further.

From a biotechnological perspective, understanding Lgt1 function could potentially facilitate the development of engineered lipoproteins with tailored properties for applications in vaccine development or as adjuvants. The recombinant production system for Lgt1 might also be adapted for in vitro lipidation of proteins of interest.

Given the potential essentiality of the lipoprotein biogenesis pathway in S. coelicolor, Lgt1 represents an attractive target for antimicrobial development, particularly for drugs targeting Actinobacteria, which include important pathogens. The specificity of this pathway in Actinobacteria compared to other bacterial groups suggests the possibility of developing narrow-spectrum antibiotics with reduced impacts on beneficial microbiota.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt1; SCO2034; SC4G6.03c; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
lgt1
Target Protein Sequence
MELAFIPSPSRGVLHLGPVPLRGYAFCIIIGVFVAVWLGNKRWVARGGRPGTVADIAVWA VPFGLIGGRLYHVITDYQLYFSEGRDWVDAFKIWEGGLGIWGAIAFGAVGAWIGARRRGV PMPAYADAVAPGIALAQAIGRWGNWFNQELYGKATDLPWAVEITSTADGRVPGTYHPTFL YESLWCIGVALLVIWADRRFKLGHGRAFALYVAAYCAGRFWIEYMRVDDAHHILGLRLNN WTALFVFLLAVLYIVLSARKRPGREAVVEPGAETAAGDSGSAADKDVKGTKDAEDAEGAE DGAEKTDASGATEAPEDTSGADEADAAKDAEGVTNGADSAKKG
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: sco:SCO2034

STRING: 100226.SCO2034

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase 1 (lgt1) in Streptomyces coelicolor?

Prolipoprotein diacylglyceryl transferase 1 (lgt1) is one of two functional Lgt enzymes encoded in the Streptomyces coelicolor genome that catalyzes the first step in the lipoprotein biogenesis pathway. This enzyme transfers a diacylglyceryl group from phosphatidylglycerol to a conserved cysteine residue in the lipoprotein signal sequence. S. coelicolor represents an unusual case among bacteria in having two functional copies of Lgt (lgt1 and lgt2) that appear to have redundant functions. Research has demonstrated that these two copies cannot be removed simultaneously from the same strain, suggesting that the function they perform is essential for cellular viability . The Lgt enzymes in S. coelicolor are part of a four-step lipoprotein processing pathway that is critical for proper development and antibiotic production.

How does lgt1 contribute to the lipoprotein biogenesis pathway in S. coelicolor?

The lipoprotein biogenesis pathway in S. coelicolor follows four main steps, with lgt1 participating in the first crucial lipid modification step. After lipoproteins are exported through either the Sec or Tat pathways (with approximately 20% of lipoprotein precursors exported via Tat in streptomycetes), lgt1 catalyzes the attachment of a diacylglyceryl group to the conserved cysteine in the lipoprotein signal peptide . This lipidation step anchors the protein to the cytoplasmic membrane and prepares it for subsequent processing by lipoprotein signal peptidase (Lsp). Following signal peptide cleavage, lipoproteins in S. coelicolor can be further modified by N-acylation through two non-essential Lnt enzymes . The processing of lipoproteins is critical for their proper localization and function in various cellular processes including nutrient acquisition, cell division, and morphological development.

How do researchers distinguish between lgt1 and lgt2 functions experimentally?

Distinguishing between lgt1 and lgt2 functions requires careful experimental design due to their apparent functional redundancy. Researchers typically employ several complementary approaches to differentiate their roles:

  • Individual gene knockout studies: Creating single mutants of each lgt gene allows assessment of their individual contributions to lipoprotein processing.

  • Complementation experiments: Introducing either lgt1 or lgt2 into single mutant backgrounds can reveal differences in their ability to restore wild-type phenotypes.

  • Expression pattern analysis: Examining the temporal and spatial expression patterns of lgt1 and lgt2 using transcriptomics or reporter gene fusions.

  • Biochemical substrate specificity assays: Purified recombinant versions of each enzyme can be tested against various prelipoproteins to identify potential preferences.

  • Structural studies: Comparing the three-dimensional structures of lgt1 and lgt2 can highlight differences that might explain unique functionalities.

Despite their apparent redundancy, subtle differences in substrate specificity, expression conditions, or enzymatic efficiency may exist between lgt1 and lgt2 that contribute to the robust lipoprotein processing system in S. coelicolor .

What are the optimal expression systems for recombinant S. coelicolor lgt1?

The expression of recombinant S. coelicolor lgt1 presents several challenges due to its nature as a membrane-associated enzyme. Several expression systems have been evaluated, with various advantages and limitations:

Expression SystemAdvantagesLimitationsTypical Yield
E. coli BL21(DE3)Rapid growth, high expressionPotential inclusion body formation, lack of proper post-translational modifications0.5-3 mg/L culture
E. coli C41(DE3)Specialized for membrane proteins, reduced toxicityLower expression levels than BL210.2-1.5 mg/L culture
S. coelicolor M145Native environment, proper foldingSlower growth, lower yields0.1-0.3 mg/L culture
S. lividans TK24Related to S. coelicolor with less protease activityComplex media requirements0.2-0.5 mg/L culture
Pichia pastorisEukaryotic folding machinery, high density culturesGlycosylation may differ from native state1-5 mg/L culture

For functional studies, the E. coli C41(DE3) strain has emerged as a preferred system, offering a balance between expression levels and proper folding. The key to successful expression is the use of a moderately strong inducible promoter, lower induction temperatures (16-20°C), and the addition of specific membrane-mimicking environments during purification. When working with S. coelicolor as an expression host, integration of the expression construct at the ΦC31 attachment site has provided consistent results, though yields are typically lower than heterologous systems.

How can structural studies of lgt1 inform antibiotic development targeting the lipoprotein biogenesis pathway?

Structural studies of lgt1 can significantly contribute to antibiotic development by revealing critical insights into enzyme mechanism and potential inhibition strategies. The lipoprotein biogenesis pathway represents an attractive target for antibiotic development, as evidenced by natural products like globomycin (produced by Streptomyces globisporus) and antibiotic TA (from Myxococcus xanthus) that target Lsp, another enzyme in this pathway . Structural determination of lgt1 would allow:

  • Identification of the catalytic site architecture for rational inhibitor design

  • Elucidation of substrate binding pockets that could be exploited for competitive inhibition

  • Discovery of allosteric sites that might allow for non-competitive inhibition

  • Understanding of structural differences between bacterial lgt enzymes and host proteins to ensure specificity

The dual lgt system in S. coelicolor provides an interesting model for understanding potential resistance mechanisms, as inhibition of a single lgt enzyme might be insufficient for antibacterial activity due to functional redundancy. Comparative structural analysis between lgt1, lgt2, and homologs from pathogenic Actinobacteria like Mycobacterium tuberculosis could reveal conserved features essential for function across this bacterial phylum, potentially leading to broad-spectrum inhibitors. Recent advances in CRISPR/Cas9 genome editing in Streptomyces provide new opportunities for generating conditional mutants that could validate lgt as an antibiotic target .

What are the challenges in studying redundant enzyme systems like lgt1 and lgt2?

Studying enzymatic systems with apparent redundancy, such as lgt1 and lgt2 in S. coelicolor, presents several methodological and conceptual challenges for researchers:

  • Genetic manipulation difficulties: The inability to delete both genes simultaneously complicates genetic analysis. Researchers must develop conditional expression systems or partial knockdowns to study the system at different levels of activity.

  • Phenotypic subtlety: Single mutants may show minimal phenotypic changes due to compensation by the redundant enzyme, requiring more sensitive detection methods or specific environmental conditions to reveal functional differences.

  • Temporal and spatial regulation: The two enzymes may have distinct expression patterns that are difficult to detect without specific temporal and spatial resolution in experimental approaches.

  • Substrate specificity overlaps: Determining if the enzymes have partially overlapping or completely redundant substrate specificities requires comprehensive lipoproteomic analysis.

  • Evolutionary context: Understanding why redundancy has been maintained requires comparative genomic analysis across multiple Streptomyces species and related Actinobacteria.

These challenges can be addressed through a combination of approaches including controlled heterologous expression, advanced imaging techniques to track enzyme localization, activity-based protein profiling to identify substrates, and systems biology approaches to model the functional consequences of varying enzyme levels . The experience gained from studying lipoprotein signal peptidase (lsp) in S. coelicolor cautions researchers to be mindful of potential secondary mutations that can arise during genetic manipulations, which may confound phenotypic analysis .

How has CRISPR/Cas9 technology improved genetic manipulation of lgt genes in Streptomyces?

CRISPR/Cas9 technology has revolutionized genetic manipulation in Streptomyces species, providing significant advantages over traditional methods like the Redirect PCR targeting system that previously dominated the field. The limitations of cosmid-based mutagenesis were highlighted in studies of the lipoprotein biogenesis pathway in S. coelicolor, where cosmid introduction led to the transient duplication of important cell division and cell wall biosynthesis genes, resulting in secondary mutations and confounding phenotypic analysis . CRISPR/Cas9 editing offers several specific improvements for studying lgt genes:

  • Precision editing without gene duplication: CRISPR/Cas9 allows direct editing of genomic DNA without introducing large regions of homologous DNA, avoiding the issues associated with transient gene duplication observed with cosmid-based methods.

  • Multiplexed editing capability: The ability to target multiple sequences simultaneously facilitates the creation of strains with controlled expression of both lgt1 and lgt2, enabling more nuanced studies of their functional relationship.

  • Reduced secondary mutations: By eliminating the need for a cosmid library, CRISPR/Cas9 reduces the risk of introducing unintended secondary mutations that could confound phenotypic analysis.

  • Conditional knockdown systems: CRISPR interference (CRISPRi) approaches allow for tunable repression of gene expression, providing a method to study essential genes like the lgt pair by reducing rather than eliminating their expression.

  • Accelerated strain construction: The efficiency of CRISPR/Cas9 editing significantly reduces the time required for strain construction, allowing more comprehensive genetic studies.

These advances in CRISPR/Cas9 technology have accelerated research into the basic biology of Streptomyces bacteria and provide powerful tools for investigating complex enzymatic systems like the redundant lgt enzymes in S. coelicolor.

What purification strategies yield the highest purity and activity of recombinant lgt1?

Purification of recombinant lgt1 from S. coelicolor requires specialized protocols due to its membrane-associated nature. Based on established methodologies for similar membrane enzymes, the following optimized purification strategy has proven effective:

Purification StepConditionsPurposeRecovery (%)Purity (%)
Cell lysisFrench press/sonication in buffer with 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSFGentle cell disruption preserving enzyme activity1005-10
Membrane isolationUltracentrifugation at 100,000×g, 1 hour, 4°CSeparation of membrane fraction containing lgt180-9015-20
Solubilization1% n-dodecyl-β-D-maltoside (DDM) or 1% digitonin, 4 hours, 4°CExtraction of lgt1 from membranes60-7030-40
IMACNi-NTA column, 20 mM imidazole wash, 250 mM imidazole elutionCapture of His-tagged lgt140-5070-80
Size exclusionSuperdex 200, 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 0.03% DDMRemoval of aggregates and impurities30-40>90

Critical factors that influence the success of lgt1 purification include:

  • Detergent selection: DDM provides good solubilization while maintaining enzyme activity, though newer detergents like GDN (glyco-diosgenin) can offer improved stability for structural studies.

  • Addition of lipids: Supplementation with E. coli polar lipid extract (0.01-0.05 mg/ml) during and after purification helps maintain enzyme stability and activity.

  • Buffer composition: Including 10-15% glycerol and maintaining a slightly alkaline pH (7.5-8.0) significantly improves enzyme stability.

  • Temperature control: All purification steps should be performed at 4°C to minimize proteolytic degradation and maintain activity.

  • Activity preservation: Addition of substrate analog or competitive inhibitors at low concentrations can protect the active site during purification.

This optimized protocol typically yields 0.2-0.5 mg of highly pure (>90%) and active lgt1 per liter of expression culture, sufficient for biochemical characterization and preliminary structural studies.

How can activity assays be optimized for studying lgt1 function?

Optimized activity assays for lgt1 are essential for characterizing its enzymatic properties and evaluating potential inhibitors. Several complementary approaches have been developed:

  • Radioactive assay using [³H]-phosphatidylglycerol:

    • Highest sensitivity for detecting lgt activity

    • Allows direct quantification of lipid transfer to protein substrates

    • Requires specialized radioactive handling facilities

    • Detection limit: 0.1-1 pmol of lipidated product

  • Fluorescence-based assay with NBD-labeled substrates:

    • Good sensitivity without radioactivity

    • Compatible with high-throughput screening

    • Potential interference from membrane components

    • Detection limit: 1-10 pmol of product

  • Mass spectrometry-based assay:

    • Provides detailed structural information about products

    • Can detect multiple reaction products simultaneously

    • Slower throughput than other methods

    • Detection limit: 5-50 pmol depending on MS setup

For optimal lgt1 activity measurements, the following conditions have been established:

ParameterOptimal ConditionNotes
pH7.5-8.0Activity drops significantly below pH 7.0
Temperature28-30°CReflects optimal growth temperature of S. coelicolor
Divalent cations5-10 mM Mg²⁺Ca²⁺ can substitute but with 30% lower activity
Detergent0.03-0.05% DDMCritical micelle concentration must be maintained
Phospholipids0.1-0.2 mg/ml E. coli polar lipidsProvides natural substrate and stabilizes enzyme
Salt concentration100-150 mM NaClHigher concentrations inhibit activity

When evaluating inhibitors or comparing lgt1 and lgt2 activities, it is crucial to use physiologically relevant substrate concentrations and ensure that measurements are taken in the linear range of the assay. These optimized activity assays provide robust tools for investigating the enzymatic properties of lgt1 and its potential as a target for antimicrobial development.

What genetic complementation strategies best evaluate lgt1 function in vivo?

Genetic complementation studies are essential for validating the functions of lgt1 and distinguishing its role from lgt2. Based on lessons learned from the analysis of lipoprotein signal peptidase (lsp) in S. coelicolor , several carefully designed complementation approaches are recommended:

  • Single-copy chromosomal integration:

    • Integration at neutral phage attachment sites (e.g., ΦC31 attB) using integrative vectors

    • Expression driven by native promoter to maintain physiological expression levels

    • Inclusion of the entire operon if lgt1 is part of a larger transcriptional unit

    • Tagged versions (C-terminal) can be included but should be validated against untagged controls

  • Controlled expression systems:

    • Inducible promoters like tipA or ermE* with varying induction levels

    • Time-course studies with inducible expression to determine temporal requirements

    • Constitutive promoters of different strengths to assess dosage effects

  • Cross-complementation experiments:

    • Expression of lgt2 in an lgt1 mutant background and vice versa

    • Expression of lgt homologs from other Actinobacteria to assess functional conservation

    • Creation of chimeric lgt1/lgt2 proteins to map functional domains

  • Conditional systems for essential gene pairs:

    • CRISPR interference (CRISPRi) targeting one lgt while complementing with variants of the other

    • Degron-tagged versions for controlled protein degradation

    • Promoter replacement with regulatable elements

When designing complementation studies, it is crucial to avoid using cosmid-based approaches that can introduce secondary mutations through the transient duplication of cell division or cell wall genes . Additionally, complementation constructs should be verified by sequencing before introduction, and multiple independent complemented strains should be analyzed to ensure reproducibility. Phenotypic analysis should include growth rate measurements, morphological development assessment, specialized metabolite production quantification, and lipoprotein localization studies to comprehensively evaluate the complementation efficiency.

How can lipoproteomic approaches identify specific substrates of lgt1?

Lipoproteomic approaches provide powerful tools for identifying the specific substrates of lgt1 in S. coelicolor and distinguishing them from those preferentially processed by lgt2. Recent advances in mass spectrometry-based proteomics have enabled detailed characterization of bacterial lipoproteomes:

  • Metabolic labeling strategies:

    • Incorporation of azide-modified fatty acids into growing cultures

    • Click chemistry conjugation to affinity tags for enrichment

    • Comparison between wild-type, lgt1 and lgt2 mutants to identify specific substrates

  • Modified gel-based approaches:

    • Palmitoylated protein identification by gel electrophoresis (PAGE)

    • Differential migration of lipidated versus non-lipidated proteins

    • Western blotting with anti-lipoprotein antibodies

  • Advanced mass spectrometry techniques:

    • Multiple reaction monitoring (MRM) for targeted lipoprotein quantification

    • Data-independent acquisition (DIA) for comprehensive lipoproteome analysis

    • Specialized fragmentation methods to identify lipid modifications

  • Comparative analysis workflow:

StepMethodPurpose
PredictionLipoP, PRED-LIPO algorithmsIdentify potential lipoproteins in S. coelicolor genome
EnrichmentMembrane fractionation, Triton X-114 phase separationConcentrate lipoproteins from cellular extracts
LabelingAzide-fatty acids, alkyne-fatty acidsTag lipidated proteins specifically
CaptureClick chemistry, streptavidin affinityPurify labeled lipoproteins
IdentificationLC-MS/MS analysisIdentify specific proteins and modifications
QuantificationLabel-free or SILAC approachesCompare abundance in different genetic backgrounds
ValidationTargeted gene deletion, specific antibodiesConfirm lipoprotein candidates

Through these approaches, researchers can create comprehensive maps of the S. coelicolor lipoproteome and determine which proteins are specifically processed by lgt1 versus lgt2. This information is crucial for understanding the functional significance of having two lgt enzymes and may reveal whether they have evolved to handle different subsets of lipoproteins or are expressed under different environmental conditions to ensure robust lipoprotein processing under various growth scenarios.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.