Recombinant Streptomyces coelicolor Protease HtpX homolog 2 (htpX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs as much as possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
htpX2; SCO4609; SCD39.09; Protease HtpX homolog 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
htpX2
Target Protein Sequence
MHRRHNGLRTAVLLGGLSALIIVIGSFFGRAGLVVAVLVALGTNAYAYWNSDKLALRAMR ARPVSEFEAPALYRMVRELSTQARQPMPRLYISPTDAPNAFATGRNPRNAAVCCTEGIMR LLDERELRGVIGHELSHVYNRDILISSVAGALASVIMFLVNFAWLIPVGRSNDDDGPGLL GMLLIMLLGPLAATVIQLAISRSREYEADASGAQLTGDPLALAGALRKLELGTKQLPLPP EPRLETASHMMIANPFRPGQGISKMFSTHPPMAERIARLEKMAGRQQ
Uniprot No.

Target Background

Database Links

KEGG: sco:SCO4609

STRING: 100226.SCO4609

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of htpX2 in Streptomyces coelicolor?

HtpX2 in S. coelicolor is encoded within the genome sequence (GenBank accession NC_003888) and represents one of the proteases involved in protein quality control. Unlike the two-component system genes such as sco5282/sco5283 that are translationally coupled, htpX2 has a distinct genomic organization. Analysis of orthologs using reciprocal BLASTP searches indicates that htpX homologs are prevalent across the Streptomycineae suborder, though with varying degrees of conservation .

How does htpX2 differ from other proteases in S. coelicolor?

S. coelicolor possesses multiple proteases involved in various cellular processes. HtpX2 belongs to the zinc-dependent membrane proteases family that typically functions in protein quality control pathways. Unlike some other proteases in S. coelicolor that may be involved in morphological development (such as those regulated by the sco5282/sco5283 two-component system), htpX2 likely plays a role in stress response and membrane protein quality control, particularly under conditions affecting protein folding or membrane integrity.

What is the predicted domain structure of htpX2?

Similar to other HtpX family proteases, S. coelicolor htpX2 likely contains transmembrane domains that anchor it to the membrane, with a zinc-binding motif in the HEXXH consensus sequence within its catalytic domain. This structure allows it to access and cleave membrane proteins that may be misfolded or damaged. The protein may also contain regions that recognize specific substrate features, though these would need to be experimentally validated through structural studies.

What expression systems are optimal for producing recombinant S. coelicolor htpX2?

The optimal expression system for recombinant htpX2 depends on research objectives. For structural studies requiring high yields, E. coli-based systems with strong inducible promoters (T7 or tac) are recommended, though membrane protein expression may require specialized strains like C41/C43(DE3) to prevent toxicity. For functional studies, Streptomyces-based expression systems provide a more native environment. When using E. coli, fusion tags like His6 or MBP can improve solubility and facilitate purification. Expression kinetics should be carefully optimized, as demonstrated in similar studies with other recombinant proteins where time courses of expression are monitored to determine optimal induction conditions .

How can I optimize codon usage for heterologous expression of htpX2?

Codon optimization is crucial when expressing S. coelicolor proteins in heterologous hosts due to the high GC content (~72%) of Streptomyces genes. When expressing in E. coli, analyze the codon adaptation index (CAI) and optimize rare codons, particularly those encoding arginine, leucine, and proline. Synthetic gene synthesis with optimized codons typically yields better results than native sequences. Additionally, consider optimizing the 5' region of the transcript to remove potential secondary structures that might impede translation initiation. Codon optimization strategies should be guided by the specific expression host to be used.

What purification strategies work best for membrane-associated proteases like htpX2?

Purification of membrane-associated proteases requires specialized approaches:

  • Solubilization Method:

    • Detergent screening (n-dodecyl-β-D-maltoside, Triton X-100, CHAPS)

    • Optimal detergent:protein ratio determination

    • Alternative: Amphipol or nanodisc technology for maintaining native-like environment

  • Chromatography Strategy:

    StepMethodBuffer CompositionPurpose
    1IMAC20 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% detergent, 20-250 mM imidazoleCapture
    2Size exclusion20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% detergentPolishing
    3Ion exchange20 mM MES pH 6.5, 0-500 mM NaCl, 0.05% detergentResolution
  • Quality Assessment:

    • SDS-PAGE with Coomassie staining (≥95% purity)

    • Western blotting with anti-His antibodies

    • Mass spectrometry verification

    • Dynamic light scattering for homogeneity

Careful temperature control (4°C) and inclusion of protease inhibitors are essential throughout the purification process to prevent autodegradation.

What assays can be used to determine the proteolytic activity of recombinant htpX2?

Multiple complementary approaches should be employed to comprehensively assess htpX2 proteolytic activity:

  • Fluorogenic Peptide Substrates:

    • FRET-based peptides containing quenched fluorophores

    • Activity measured as increased fluorescence upon cleavage

    • Allows kinetic parameter determination (kcat, KM)

  • Membrane Protein Degradation Assays:

    • Reconstituted proteoliposomes with model substrates

    • Quantification via SDS-PAGE or western blotting

    • Time-course experiments to determine degradation rates

  • In vivo Complementation:

    • Expression in htpX-deficient bacterial strains

    • Assessment of phenotype rescue under stress conditions

    • Similar to genetic complementation approaches used in two-component system studies

  • Activity Modulation Analysis:

    ConditionExpected EffectMeasurement Method
    EDTAInhibition% Residual activity
    Zn2+EnhancementFold increase in activity
    pH optimizationBell curvepH-activity profile
    TemperatureVariableThermal stability assay
    Reducing agentsVariableThiol-dependence assessment

For all activity measurements, appropriate controls including heat-inactivated enzyme and catalytic mutants should be included.

How can I identify the physiological substrates of htpX2 in S. coelicolor?

Identifying physiological substrates requires multiple approaches. First, generate an htpX2 deletion mutant in S. coelicolor and compare the membrane proteome with wild-type using quantitative proteomics. Proteins that accumulate in the deletion strain are potential substrates. Second, use proximity-labeling approaches with a catalytically inactive htpX2 variant to capture interacting proteins. Third, employ in vitro degradation assays with candidate substrates identified from the previous approaches. Finally, validate findings using co-immunoprecipitation and in vivo protein stability assays. When analyzing results, focus on membrane proteins involved in stress response pathways, as these are common substrates for HtpX family proteases.

What role might htpX2 play in S. coelicolor stress response?

HtpX2 likely functions in protein quality control during stress conditions. To investigate this, expose wild-type and htpX2 mutant strains to various stressors (heat shock, oxidative stress, membrane-targeting antibiotics) and assess survival rates, morphology, and proteome changes. Monitor htpX2 expression under these conditions using RT-qPCR or reporter fusions. Additionally, examine whether htpX2 expression is regulated by stress-responsive transcription factors. Compare your findings with known stress response mechanisms in S. coelicolor, such as those regulated by two-component systems like sco5282/sco5283 , to build a comprehensive understanding of how htpX2 contributes to cellular homeostasis during stress.

What approaches are best for solving the structure of membrane-bound htpX2?

Determining the structure of membrane-bound htpX2 requires specialized techniques:

When interpreting structural data, compare with known structures of HtpX family members, focusing on the catalytic zinc-binding site and substrate binding regions.

How can I determine the metal coordination in the active site of htpX2?

The metal coordination in htpX2's active site can be characterized through complementary approaches. X-ray absorption spectroscopy (XAS), particularly EXAFS (Extended X-ray Absorption Fine Structure), can determine the coordination geometry and interatomic distances between the zinc ion and coordinating ligands. Site-directed mutagenesis of predicted metal-coordinating residues (typically histidines in the HEXXH motif) coupled with activity assays and metal content analysis can confirm residues involved in coordination. Isothermal titration calorimetry (ITC) can determine metal binding affinities. Additionally, crystallography with anomalous scattering at the zinc absorption edge can pinpoint the exact location of the metal. These approaches collectively provide a comprehensive picture of the active site architecture.

What techniques are available for studying the conformational changes in htpX2 during catalysis?

Studying conformational changes in htpX2 during catalysis requires techniques that capture protein dynamics. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map regions that undergo conformational changes upon substrate binding by measuring the rate of hydrogen exchange with deuterium. Single-molecule FRET can monitor distance changes between strategically placed fluorophores during the catalytic cycle. Time-resolved cryo-EM can capture different conformational states. Molecular dynamics simulations can predict conformational transitions, while electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling can measure distances between specific residues. These techniques should be applied with catalytically inactive mutants and transition state analogs to capture intermediate states in the catalytic cycle.

How might htpX2 interaction with two-component systems affect S. coelicolor physiology?

Investigation of htpX2 interaction with two-component systems requires system-level analysis. First, examine whether htpX2 expression is regulated by known two-component systems in S. coelicolor, particularly those involved in stress response like sco5282/sco5283 . Perform ChIP-seq to identify response regulators that bind to the htpX2 promoter region. Conversely, investigate whether htpX2 proteolytically processes components of two-component systems by comparing phosphorylation patterns and protein levels in wild-type and htpX2 mutant strains. Construct double mutants (htpX2 deletion plus mutations in two-component systems) to identify genetic interactions. Finally, use phosphoproteomics to identify signaling changes when htpX2 is absent or overexpressed, focusing on phosphorylation events typical of two-component signal transduction.

What is the potential role of htpX2 in antibiotic production in S. coelicolor?

To investigate htpX2's role in antibiotic production, compare metabolite profiles of wild-type, htpX2 deletion, and overexpression strains using LC-MS/MS. Quantify production of known S. coelicolor antibiotics (actinorhodin, undecylprodigiosin, calcium-dependent antibiotic) under various growth conditions. Examine whether htpX2 affects expression of antibiotic biosynthetic gene clusters through RNA-seq analysis. Investigate potential proteolytic regulation of transcription factors known to control antibiotic production. Consider that membrane proteases like htpX2 might influence antibiotic export or precursor import through regulating membrane transporters. Compare your findings with known regulators of secondary metabolism in S. coelicolor, such as those influenced by two-component systems , to place htpX2 within the broader regulatory network.

How can CRISPR-Cas9 technology be optimized for studying htpX2 function in S. coelicolor?

Optimizing CRISPR-Cas9 for htpX2 functional studies requires specialized considerations for Streptomyces:

  • Vector System Selection:

    • Temperature-sensitive replicons for transient expression

    • Integrative vectors for stable editing

    • Inducible promoters for controlled Cas9 expression

  • sgRNA Design Strategy:

    ParameterRecommendationRationale
    GC content40-60%Balance binding energy
    Target location5' end of geneEnsure complete disruption
    PAM selectionNGG sites with high specificity scoreMinimize off-targets
    Secondary structureMinimize hairpinsImprove efficiency
  • Editing Approaches:

    • Gene knockout: Design repair template with stop codons in all frames

    • Point mutations: 40-50bp homology arms flanking the desired mutation

    • Domain deletions: Precise in-frame removal of functional domains

    • Reporter fusions: C-terminal tagging preserving membrane localization

  • Screening Protocol:

    • Antibiotic selection for plasmid maintenance

    • PCR verification of edits

    • Sanger sequencing confirmation

    • Phenotypic validation

    • Western blotting for protein expression

Special consideration should be given to the high GC content of Streptomyces genomes when designing sgRNAs, and codon-optimized Cas9 should be used for efficient expression.

How does htpX2 contribute to stress-induced DNA damage response in S. coelicolor?

The relationship between htpX2 and DNA damage response can be investigated by exposing wild-type and htpX2 mutant strains to DNA-damaging agents (UV, mitomycin C, ionizing radiation). Compare survival rates, DNA repair kinetics, and mutation frequencies between strains. Use chromatin immunoprecipitation to examine recruitment of DNA repair proteins to damage sites in both backgrounds. Investigate whether htpX2 proteolytically regulates DNA damage response proteins by comparing their stability and modification states. This approach parallels studies of TPX2 in eukaryotes, which demonstrated its role in DNA damage response through regulating γ-H2AX levels following ionizing radiation . Although htpX2 and TPX2 are unrelated proteins, their potential roles in stress response provide a conceptual framework for investigation.

What computational methods can predict substrate specificity of htpX2?

Predicting htpX2 substrate specificity requires a multi-faceted computational approach. Begin with homology modeling based on structures of related proteases, focusing on the substrate-binding pocket. Use molecular docking of peptide libraries to identify preferred sequence motifs. Apply machine learning algorithms trained on known protease-substrate pairs to predict potential cleavage sites in the S. coelicolor proteome. Perform molecular dynamics simulations to understand substrate binding dynamics and enzyme flexibility. Integrate these predictions with biological context by analyzing membrane topology and accessibility of predicted cleavage sites. Validate computational predictions experimentally using synthetic peptide libraries and proteomics approaches.

How does htpX2 compare to its homologs in other Streptomyces species?

Comparative analysis of htpX2 across Streptomyces species provides evolutionary insights:

  • Phylogenetic Analysis:

    • Construct maximum likelihood trees of htpX homologs

    • Identify cases of gene duplication or horizontal transfer

    • Correlate with species ecological niches

  • Sequence Conservation Patterns:

    DomainConservation LevelImplication
    Catalytic motifHighFunctional constraint
    Transmembrane regionsModerateTopological importance
    Substrate recognitionVariableHost-specific adaptations
    Regulatory regionsLow-ModerateSpecies-specific regulation
  • Comparative Genomics:

    • Synteny analysis of genomic context

    • Co-evolution with substrate proteins

    • Correlation with secondary metabolite gene clusters

  • Expression Pattern Comparison:

    • RNA-seq data analysis across species

    • Identification of conserved vs. species-specific regulatory elements

    • Correlation with stress response pathways

This approach is similar to the analysis of the sco5282/sco5283 two-component system, which was found to be prevalent in Streptomycineae but not in other actinomycetes suborders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.