Recombinant Streptomyces coelicolor Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Functional Role in Protein Translocation

SecF operates within the SecYEG-SecDF complex to enhance the efficiency of SecA-dependent protein export. Key functions include:

  • Translocase Activity: Assists in ATP-driven polypeptide translocation by stabilizing SecA-SecYEG interactions .

  • Redundancy with SecDF: S. coelicolor uniquely possesses both fused (secDF) and separated (secD/secF) homologs. Deletion studies show:

    • Double deletions (secDF + secD/secF) reduce secretion efficiency of Xylanase A and Amylase C by >50% .

    • secD/secF contributes more prominently to secretion than secDF .

  • Evolutionary Divergence: Phylogenetic analyses suggest secD/secF evolved via vertical gene transfer, while secDF likely arose through horizontal gene transfer or gene duplication .

Transcriptional and Functional Analyses

  • Expression Levels: secD and secF transcripts are 3–5× more abundant than secDF under standard growth conditions .

  • Redundant Roles: Both homologs compensate for each other, but secD/secF is indispensable for efficient secretion during secondary metabolism .

  • Interaction with Tat Pathway: SecF collaborates indirectly with the Tat system in membrane protein assembly (e.g., Rieske protein integration) .

Comparative Secretion Efficiency

StrainXylanase A SecretionAmylase C Secretion
Wild-type100%100%
ΔsecDF85%78%
ΔsecD/secF62%54%
ΔsecDF + ΔsecD/secF41%37%
Data adapted from

Applications in Biotechnology

Recombinant SecF is utilized to study:

  • Protein Secretion Mechanisms: Essential for optimizing Streptomyces as a host for industrial enzyme production .

  • Translocase Engineering: Modifying SecDF homologs improves yields of heterologous proteins (e.g., antibodies, hydrolases) .

  • Evolutionary Studies: Insights into horizontal gene transfer events in Actinobacteria .

Future Directions

Ongoing research aims to:

  • Resolve the cryo-EM structure of SecF in complex with SecYEG.

  • Engineer secF promoters to enhance secretory capacity in industrial strains.

  • Explore crosstalk between Sec and Tat pathways in polytopic membrane protein assembly .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference when placing your order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize fulfilling your request.
Synonyms
secF; SCO1515; SCL2.05c; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-373
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
secF
Target Protein Sequence
MSKLGTLGARLHHGEVGYDFVKNRKIWYGISILITITAIVGLAVRGLHMGIEFQGGAVFT TPKNMSASVAQTETWAEEASGHDAIVQKLGDGSLRIQIAGTDTQQSDQIKEDLSKNLDVS AEKINADLVGPSWGDQIANKAWQGLGIFMVLVVIYLAIAFEWRMALAAFVALIHDITITV GIYALVGFEVTPGTVIGLLTILGYSLYDTVVVFDSLKEQTRDITKQTRWTYAEIANRSIN STLVRSINTTVVALLPVAGLLFIGGGVLGAGMLNDISLSLFVGLAAGAYSSIFIATPLVA DLKEAEPQMKALKKRVLAKRAQGAAKGESAESAADEGAYDADEPDDAAPAVVGPRNQPAS RGRGRGRPSGKRR
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links

KEGG: sco:SCO1515

STRING: 100226.SCO1515

Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the unique feature of SecF in Streptomyces coelicolor compared to other bacteria?

Streptomyces coelicolor possesses two different forms of secDF homologous genes: one in fused form (secDF) and the other in separated form (secD and secF). This is unusual compared to most bacterial species which typically contain only one form. Examination of S. coelicolor genome revealed this unexpected presence of both forms, with the separated secD and secF genes showing significantly higher transcript levels than the fused secDF version . This unique characteristic suggests potential functional specialization or redundancy that may provide adaptive advantages to Streptomyces.

How do the functional roles of SecF and SecDF differ in S. coelicolor?

While both SecF (as part of the SecD/SecF complex) and SecDF contribute to protein translocation in S. coelicolor, they appear to have different levels of influence on secretion efficiency. Deletion studies demonstrated that SecD/SecF plays a more prominent role than SecDF in protein translocation. Both components showed redundant functions for Sec-dependent translocation, as deletion of either secDF or secD/secF resulted in reduced secretion efficiency of tested proteins like Xylanase A and Amylase C . The complementary yet distinct roles suggest evolutionary adaptation to enhance the protein transport capacity in Streptomyces.

What evolutionary history explains the presence of both SecF and SecDF in Streptomyces?

Evolutionary analysis suggests that the fused and separated SecDF homologs in Streptomyces likely have disparate evolutionary ancestries. The separated SecD/SecF proteins appear to have originated from vertical transmission from ancestors of Streptomyces species. In contrast, the fused SecDF form may have been acquired through horizontal gene transfer from other bacterial lineages, or alternatively, it may have arisen through gene duplication and fusion events . The acquisition of this second copy likely conferred selective advantages to Streptomyces by enhancing their protein transport capacity.

What expression systems are most effective for producing recombinant S. coelicolor SecF?

For recombinant production of S. coelicolor SecF, E. coli-based expression systems have proven effective. As demonstrated with other SecF proteins, such as from Mycobacterium leprae, the protein can be successfully expressed as a full-length construct (typically spanning all 471 amino acids) with an N-terminal His-tag for purification purposes . For optimal expression, vectors with strong inducible promoters (such as T7 or tac) should be used, with expression conditions typically involving induction at mid-log phase (OD600 ~0.6-0.8) followed by growth at reduced temperatures (16-25°C) to enhance proper folding of this membrane protein.

What purification challenges are specific to recombinant SecF?

Purifying functional SecF presents several challenges due to its nature as a membrane protein:

  • Solubilization: Effective detergent selection is critical, with n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) typically yielding good results

  • Stability: SecF tends to aggregate during purification, requiring buffer optimization with glycerol (5-50%) as a stabilizing agent

  • Functional assessment: Unlike soluble proteins, assessing functionality requires reconstitution into membranes or liposomes

For optimal results, immobilized metal affinity chromatography (IMAC) using Ni-NTA columns followed by size exclusion chromatography has been demonstrated to yield high-purity protein suitable for functional studies.

How can researchers verify the functionality of purified recombinant SecF?

Verifying SecF functionality requires demonstrating its ability to participate in protein translocation. Methodologies include:

  • Proteoliposome reconstitution assays to measure ATP-dependent protein translocation

  • In vivo complementation of secF deletion strains to restore secretion phenotypes

  • ATPase activity measurements in the presence of other Sec components

  • Binding assays with known interaction partners from the Sec machinery

Researchers should establish baseline secretion efficiency in wild-type versus secF-deficient strains using model secreted proteins like Xylanase A, then demonstrate restoration of this activity with the purified recombinant protein .

What protein-protein interactions are critical for SecF function in S. coelicolor?

SecF functions as part of the multicomponent Sec translocase system, where protein-protein interactions are essential for its activity. Key interactions include:

  • Association with SecD to form the SecDF complex that enhances protein translocation efficiency

  • Interaction with SecYEG, the central translocon component

  • Potential interactions with motor proteins like SecA that provide energy for translocation

The SecDF complex is thought to function by utilizing proton motive force to enhance the late stages of protein translocation, potentially through conformational changes that prevent backward sliding of the translocating polypeptide .

How do mutations in conserved regions of SecF affect protein secretion?

Mutation RegionEffect on SecretionProposed Mechanism
Transmembrane domainsSevere reductionDisruption of membrane integration
Periplasmic loopsModerate to severeAltered interaction with substrate proteins
ATP-binding siteModerate reductionImpaired energy coupling
SecD interaction interfaceSevere reductionDisrupted complex formation

Mutations in the transmembrane domains and SecD interaction interfaces typically result in the most significant impairment of secretion efficiency, underscoring the importance of both membrane integration and complex formation for SecF function .

What techniques are most informative for studying SecF structure-function relationships?

To elucidate SecF structure-function relationships, researchers should consider:

  • Cryo-electron microscopy for structural determination within the context of the Sec complex

  • Site-directed mutagenesis coupled with functional assays to identify critical residues

  • Crosslinking studies to map interaction interfaces with other Sec components

  • Molecular dynamics simulations to understand conformational changes during the translocation cycle

These approaches can provide complementary insights into how SecF contributes to the mechanics of protein translocation across the cytoplasmic membrane.

How is secF expression regulated in S. coelicolor under different growth conditions?

Transcriptional analysis reveals that secF expression in S. coelicolor is constitutive, but relative expression levels vary with growth conditions. The transcript levels of the separated secD and secF genes are significantly higher than the fused secDF under standard laboratory growth conditions . During stress conditions or growth in minimal media, the expression patterns may shift to accommodate changing secretory needs. For instance, in reduced genome strains of Streptomyces, the gene encoding the bifunctional preprotein translocase subunit SecDF was upregulated 1.8-fold, suggesting compensatory mechanisms when certain genomic elements are removed .

What is the relationship between SecF function and secondary metabolite production in S. coelicolor?

SecF function appears to indirectly influence secondary metabolite production in S. coelicolor through its role in protein secretion. The Sec pathway is involved in the export of enzymes and regulators that affect antibiotic biosynthesis. For example:

  • In reduced genome strains with altered secretion profiles, transcription levels of secondary metabolite gene clusters, including act, red, cda, and cpk clusters, showed significant changes

  • SARPs (Streptomyces antibiotic regulatory proteins) like ActII-ORF4, RedD, CdaR, and CpKO, which regulate secondary metabolism, showed altered expression patterns in strains with modified secretion capabilities

  • The upregulation of secDF correlates with enhanced protein secretion in certain Streptomyces strains, which may indirectly influence secondary metabolite production

How does SecF function in the context of S. coelicolor's complex life cycle?

SecF function appears to be integrated with S. coelicolor's developmental program, potentially through:

  • Differential expression during morphological differentiation phases

  • Involvement in the secretion of enzymes required for aerial mycelium formation

  • Contribution to the export of proteins involved in stress responses during stationary phase

The constitutive expression of secF suggests its importance throughout the life cycle, but its relative contribution may vary depending on the specific developmental stage and environmental conditions .

How can CRISPR-Cas9 technology be applied to study SecF function in S. coelicolor?

CRISPR-Cas9 offers precise genetic manipulation capabilities for studying SecF in S. coelicolor:

  • Generation of clean deletion mutants: Create secF knockout strains without polar effects on adjacent genes

  • Domain swapping: Replace specific domains between SecF and SecDF to determine functional equivalence

  • Site-specific mutagenesis: Introduce point mutations to test the importance of specific residues

  • Promoter engineering: Modify native secF promoter to control expression levels

  • Tagging: Add fluorescent or affinity tags to study localization and interaction dynamics

For effective implementation, researchers should design sgRNAs targeting unique regions of secF with minimal off-target effects, and include appropriate homology arms for targeted integration of repair templates.

What proteomics approaches can reveal the impact of SecF on the S. coelicolor secretome?

Comprehensive proteomics strategies can elucidate SecF's role in shaping the S. coelicolor secretome:

  • Comparative secretome analysis: Two-dimensional difference in gel electrophoresis (2D-DIGE) followed by nanoliquid chromatography coupled to mass spectrometry (nanoLC-ESI-LIT-MS/MS) to compare wild-type and secF-deficient strains

  • Quantitative proteomics: Stable isotope labeling or label-free quantification to determine differential protein abundance

  • Targeted proteomics: Selected reaction monitoring (SRM) to track specific SecF-dependent secreted proteins

  • Protein-protein interaction mapping: Proximity labeling approaches to identify proteins in close association with SecF during translocation

Analysis of a secF deletion strain showed reduced secretion efficiency of model proteins, suggesting that comprehensive proteomics would reveal global changes in protein export patterns .

How can mathematical modeling enhance our understanding of SecF-mediated protein translocation?

Mathematical modeling provides valuable insights into the complex kinetics of SecF-mediated protein translocation:

  • Ordinary differential equation (ODE) models: Capture the temporal dynamics of protein translocation rates

  • Stochastic models: Account for the probabilistic nature of protein-protein interactions during translocation

  • Structural models: Predict conformational changes in SecF during the translocation cycle

  • Multi-scale models: Integrate molecular interactions with cellular-level secretion phenotypes

These models can be parameterized using experimental data from in vitro translocation assays and validated against in vivo measurements of protein secretion efficiency in different genetic backgrounds (wild-type, ΔsecF, ΔsecDF, and double mutants) .

What strategies can address poor yield of recombinant SecF expression?

When facing poor yields of recombinant SecF, researchers should consider:

  • Expression system optimization:

    • Test different E. coli strains (BL21(DE3), C41(DE3), C43(DE3) designed for membrane proteins)

    • Adjust induction conditions (temperature, inducer concentration, duration)

    • Try auto-induction media to achieve gradual protein expression

  • Construct modifications:

    • Include solubility-enhancing tags (MBP, SUMO)

    • Express periplasmic domains separately if full-length protein is problematic

    • Codon optimization for the expression host

  • Stabilization approaches:

    • Add glycerol (6-50%) to buffers to enhance stability

    • Include appropriate detergents for membrane protein solubilization

    • Use trehalose (6%) in storage buffers to maintain protein integrity during freeze-thaw cycles

How can researchers distinguish between the functions of SecF and SecDF in S. coelicolor?

To differentiate between SecF and SecDF functions:

  • Genetic approach:

    • Generate single (ΔsecF or ΔsecDF) and double mutants (ΔsecF/ΔsecDF)

    • Perform complementation studies with each gene individually

    • Create chimeric proteins by domain swapping between SecF and SecDF

  • Biochemical approach:

    • Purify individual proteins and reconstitute in liposomes

    • Measure translocation efficiency of model substrates with each component

    • Analyze ATP hydrolysis and proton motive force utilization

  • Transcriptomic/proteomic approach:

    • Compare global expression patterns in each mutant background

    • Identify differentially affected secreted proteins

    • Measure transcript levels under various growth conditions

Research has shown that while both proteins contribute to secretion, SecD/SecF plays a more prominent role than SecDF in protein translocation in S. coelicolor .

What controls are essential when evaluating SecF function in protein secretion assays?

When designing protein secretion assays to evaluate SecF function, include these critical controls:

  • Strain controls:

    • Wild-type S. coelicolor (positive control)

    • SecF deletion mutant (negative control)

    • Complemented strain (restoration control)

    • SecA depletion strain (general secretion inhibition control)

  • Protein controls:

    • Sec-dependent secreted proteins (Xylanase A, Amylase C)

    • Tat-dependent secreted protein (negative control)

    • Cytoplasmic protein marker (lysis control)

  • Experimental controls:

    • Growth curve monitoring to normalize for growth differences

    • Cell fractionation quality controls (membrane, cytoplasm, secreted fractions)

    • Time-course sampling to capture secretion dynamics

  • Analysis controls:

    • Loading controls for gel-based assays

    • Internal standards for quantitative proteomics

    • Multiple biological and technical replicates

How might engineering SecF enhance heterologous protein production in Streptomyces expression systems?

Engineering SecF for enhanced protein production could involve:

  • Overexpression strategies:

    • Controlled upregulation of native secF to enhance secretion capacity

    • Co-expression with other limiting Sec components

    • Promoter engineering for coordinated expression with target proteins

  • Protein engineering approaches:

    • Identify and modify rate-limiting domains based on structural studies

    • Create chimeric SecF proteins incorporating efficient features from other species

    • Directed evolution to select for variants with enhanced translocation activity

  • System-level modifications:

    • Coordinate SecF enhancement with upregulation of chaperones and foldases

    • Engineer post-translocation modifications to improve protein stability

    • Reduce proteolytic degradation of secreted proteins

Notably, in reduced genome strains of Streptomyces, upregulation of secDF and stress-related chaperones correlated with elevated polypeptide secretion, suggesting that rational manipulation of these components could enhance protein production capabilities .

What is the potential relationship between SecF function and antibiotic production in Streptomyces?

The relationship between SecF and antibiotic production appears to involve:

  • Secretion of regulatory proteins:

    • Export of extracellular signaling molecules that trigger antibiotic production

    • Secretion of enzymes involved in precursor processing

  • Stress response integration:

    • The cell envelope stress response affected by SecF function may influence antibiotic production

    • Two-component systems (TCS) that enhance both antibiotic and protein secretion share regulatory pathways

  • Growth phase coordination:

    • SecF activity may be coordinated with transition between growth phases when antibiotic production is initiated

    • Secondary metabolite gene clusters show transcript level changes in coordination with secretion pathway modifications

Studies in S. coelicolor have shown that mutations affecting secretion can significantly impact production of antibiotics like actinorhodin (ACT), calcium-dependent antibiotic (CDA), and undecylprodigiosin .

How might advanced imaging techniques advance our understanding of SecF localization and dynamics?

Advanced imaging approaches offer new opportunities to understand SecF function:

  • Super-resolution microscopy:

    • Visualize the nanoscale organization of SecF within the membrane

    • Track dynamic assembly and disassembly of Sec translocons

    • Map the spatial distribution relative to other cellular components

  • Single-molecule tracking:

    • Measure the diffusion dynamics of SecF in living cells

    • Detect transient interactions with substrate proteins and other Sec components

    • Quantify dwell times during active translocation events

  • FRET-based approaches:

    • Monitor conformational changes during the translocation cycle

    • Detect interactions between SecF and other components in real-time

    • Measure distances between domains during functional states

  • Correlative light and electron microscopy:

    • Connect functional observations with ultrastructural details

    • Visualize SecF in the context of membrane invaginations and cell envelope architecture

    • Study SecF distribution during different growth phases, including during the transition to aerial hyphae formation in Streptomyces

These techniques would provide unprecedented insights into how SecF functions within the complex cellular environment of Streptomyces.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.