Recombinant Streptomyces coelicolor Putative zinc metalloprotease SCO5695 (SCO5695)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Streptomyces coelicolor Putative Zinc Metalloprotease SCO5695 (SCO5695)

Recombinant Streptomyces coelicolor Putative zinc metalloprotease SCO5695 (SCO5695) is a protein that is found in Streptomyces coelicolor, which is a filamentous soil bacterium that produces several kinds of antibiotics . SCO5695 is a putative zinc metalloprotease, which means it is predicted to be a zinc-dependent enzyme that breaks down proteins .

Basic Information

PropertyValue
Product CodeCSB-YP881666FOB1
AbbreviationSCO5695
UniProt No.Q9KYS0
Product TypeRecombinant Protein
Immunogen SpeciesStreptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Purity>85% (SDS-PAGE)
SourceYeast
Target NamesSCO5695
Protein NamesRecommended name: Putative zinc metalloprotease SCO5695 EC= 3.4.24.-
Protein LengthPartial

Function and Characteristics

Streptomyces coelicolor is known for producing four genetically and structurally distinct antibiotics: actinorhodin and undecylprodigiosin, which are pigmented antibiotics . Zinc metalloproteases are a family of enzymes that utilize a zinc ion to catalyze the hydrolysis of peptide bonds in proteins .

SCO5695 is expressed in E. coli systems and is tagged during manufacturing, though the specific tag type is determined during the manufacturing process .

Role in Antibiotic Production and Secondary Metabolism

S. coelicolor produces a variety of bioactive secondary metabolites, including antibiotics, immunosuppressants, and anticancer agents . The control machinery for secondary metabolism in Streptomyces is complex . Mutants lacking the zinc-responsive Zur repressor are conditionally defective in sporulation, which is possibly caused by the overexpression of one or more Zur target genes .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SCO5695; SC5H4.19; Putative zinc metalloprotease SCO5695
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-430
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
SCO5695
Target Protein Sequence
MFILGIVLFAVGLLFSIAWHELGHLSTAKMFGIRVPQYMVGFGPTLFSKKKGDTEYGVKA IPFGGYIRMIGMFPPGPDGRMEARSTSPWRGMIEDARSAAFEELQPGDEKRLFYTRKPWK RVIVMFAGPFMNLILAVVLFLTVLMGFGISQQTTTVSSVSQCVISQSENPDDCAKSDPAS PAAAAGLRAGDKILAFDGVRTDDWDKLSDLIRANPGEDVPVVVERKGEEITLHATIATNK VAKKDSNGQIVQGEYVTAGFLGFSSATGVVKQDFGQSVTWMGDRIGDAVDNLAALPAKIP ALWDAAFGDGPREADSPMGVVGAARVGGEIATLDIPPTQQLAMFVMLVAGFNLSLFLFNM LPLLPLDGGHIAGALWESLRRATAKVLRRPDPGPFDVAKLMPVAYVVAGVFVCFTLLVLV ADVVNPVRIT
Uniprot No.

Target Background

Database Links

KEGG: sco:SCO5695

STRING: 100226.SCO5695

Protein Families
Peptidase M50B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does SCO5695 compare to other zinc metalloproteases?

SCO5695 belongs to the broader family of zinc metalloproteases, which are characterized by the conserved HEXXH motif in their active site . While SCO5695 has not been as extensively characterized as some other zinc metalloproteases, comparisons can be drawn with better-studied homologs.

FeatureSCO5695Other Zinc Metalloproteases (e.g., IgA1, ZmpB, ZmpC, ZmpD)
Active site motifHEXXH...EHEXXH...E
Length430 amino acidsVariable (typically 1000-2000 aa)
Cellular locationLikely membrane-associatedOften cell wall-anchored (LPXTG motif)
Known functionPutative, not fully characterizedVarious (IgA1: cleaves IgA; ZmpB: affects TNF-α levels)
Evolutionary relationshipUnknownResult of gene duplications

Unlike the well-characterized zinc metalloproteases such as IgA1 protease, ZmpB, ZmpC, and ZmpD found in pneumococci, the specific substrate and physiological role of SCO5695 in S. coelicolor remain to be fully elucidated . Phylogenetic analyses of zinc metalloproteases typically reveal distinct clusters, with some proteases being more closely related than others, but SCO5695's precise evolutionary relationship has not been extensively studied in the available literature.

What are the optimal conditions for expressing recombinant SCO5695?

Expression of recombinant SCO5695 has been successfully achieved in E. coli expression systems. The following protocol represents a standard approach based on available literature:

  • Gene cloning: The SCO5695 gene sequence (coding for amino acids 1-430) is typically cloned into an expression vector with an N-terminal His-tag for purification purposes .

  • Expression conditions:

    • Host strain: E. coli BL21(DE3) or similar strains

    • Culture medium: LB broth supplemented with appropriate antibiotics

    • Induction: IPTG (typically 0.5-1 mM) when culture reaches OD600 of 0.6-0.8

    • Post-induction growth: 16-18 hours at 16-18°C to enhance proper folding

  • Critical factors affecting expression:

    • Temperature: Lower temperatures (16-18°C) during induction often improve solubility

    • IPTG concentration: Optimization may be necessary (0.1-1.0 mM range)

    • Growth phase: Induction during mid-log phase typically yields better results

    • Media composition: Rich media like TB (Terrific Broth) may increase yield

Researchers should note that as a putative metalloprotease, SCO5695 may require specific cofactors (zinc ions) for proper folding and activity. Supplementing the growth medium with ZnCl₂ (10-50 μM) might improve the production of correctly folded protein.

What purification strategies are most effective for recombinant SCO5695?

The purification of His-tagged recombinant SCO5695 typically follows a multi-step process to ensure high purity and activity:

  • Cell lysis:

    • Mechanical disruption (sonication or French press) in an appropriate buffer (typically Tris-based, pH 8.0)

    • Addition of protease inhibitors (excluding metal chelators if activity is to be preserved)

    • Inclusion of low concentrations of non-ionic detergents may help if the protein associates with membranes

  • Initial purification:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Wash with increasing imidazole concentrations (20-50 mM)

    • Elution with higher imidazole (250-300 mM)

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and impurities

    • Ion exchange chromatography may be employed as an additional step

  • Storage considerations:

    • The purified protein should be stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C

    • Working aliquots can be kept at 4°C for up to one week

    • Repeated freeze-thaw cycles should be avoided

Protein purity should be assessed using SDS-PAGE, with expected purity greater than 90% . For functional studies, it's crucial to verify that the protein retains its metalloprotease activity after purification.

How can the proteolytic activity of SCO5695 be experimentally assessed?

As a putative zinc metalloprotease, SCO5695's enzymatic activity can be evaluated using several complementary approaches:

  • Generic protease assays:

    • Fluorogenic peptide substrates: Compounds that release fluorescent groups upon cleavage

    • Casein zymography: Gel-based technique where proteolytic activity appears as clear zones

    • Azocasein assay: Colorimetric method measuring release of azo dye from protein substrate

  • Substrate specificity determination:

    • Peptide libraries: Screening against synthetic peptide collections

    • Proteomic approaches: Incubation with complex protein mixtures followed by mass spectrometry

    • Targeted substrate candidates: Testing against proteins known to interact with S. coelicolor

  • Inhibition studies:

    • Metal chelators (EDTA, 1,10-phenanthroline): Should inhibit activity if truly a metalloprotease

    • Zinc-specific inhibitors: To confirm zinc dependence

    • pH and temperature profiling: To determine optimal conditions for activity

When designing these experiments, researchers should include appropriate controls, including heat-inactivated enzyme, assays with metal chelators, and assays with known metalloproteases. Since the exact natural substrate of SCO5695 is unknown, initial screening should employ broad-spectrum substrates before moving to more targeted approaches.

What techniques can be used to identify potential physiological substrates of SCO5695?

Identifying the natural substrates of SCO5695 represents a significant challenge that requires multiple experimental approaches:

  • In vivo approaches:

    • Gene knockout studies in S. coelicolor M145 strain followed by phenotypic analysis

    • Overexpression studies to observe potential gain-of-function effects

    • Comparative proteomics between wild-type and SCO5695 mutant strains to identify differentially processed proteins

  • In vitro approaches:

    • Protein interaction studies (pull-down assays, yeast two-hybrid) to identify binding partners

    • Incubation of cell extracts with purified SCO5695 followed by N-terminal sequencing or mass spectrometry

    • PICS (Proteomic Identification of Cleavage Sites) technology

  • Computational approaches:

    • Homology-based prediction comparing SCO5695 to better-characterized zinc metalloproteases

    • Structural modeling to predict substrate binding sites

    • Analysis of genomic context and gene neighborhood for functional associations

Researchers should note that many zinc metalloproteases show activity toward multiple substrates, and the physiological relevance of each interaction needs to be carefully validated. The use of S. coelicolor strain M145, which was used for the genome sequencing project, is recommended for consistency with genomic data .

How might SCO5695 contribute to Streptomyces coelicolor developmental biology?

While the specific role of SCO5695 in S. coelicolor development has not been fully characterized, several hypotheses can be proposed based on our knowledge of zinc metalloproteases and Streptomyces biology:

  • Morphological development:

    • S. coelicolor undergoes complex developmental stages including aerial mycelium formation and sporulation

    • Proteases often play roles in remodeling cell walls and extracellular matrices during development

    • SCO5695 might process proteins involved in the Bld (bald) or Whi (white) regulatory pathways that control aerial mycelium formation and sporulation

  • Secondary metabolism connections:

    • S. coelicolor is known for producing antibiotics and other secondary metabolites

    • Proteolytic processing could activate or inactivate regulatory proteins in metabolic pathways

    • SCO5695 might function at the interface between morphological development and secondary metabolism

  • Environmental adaptation:

    • As a predicted membrane-associated protein, SCO5695 could be involved in sensing or responding to environmental signals

    • It might process surface proteins that interact with the environment or neighboring cells

Experimental approaches to investigate these hypotheses would include creating precise gene deletions or conditional mutations in SCO5695, followed by detailed phenotypic analysis under various growth conditions. Microscopic examination of developmental stages in these mutants, coupled with transcriptomic and proteomic analyses, would provide insights into the protein's function.

What is known about the regulation of SCO5695 expression in different growth phases?

  • Developmental regulation:

    • Streptomyces genes are often regulated in a growth phase-dependent manner

    • Expression profiles might correlate with specific developmental stages (vegetative growth, aerial mycelium formation, or sporulation)

    • Analysis of promoter regions for developmental regulator binding sites (BldD, WhiG, etc.) could provide insights

  • Environmental regulation:

    • Expression might respond to nutrient availability, particularly zinc levels given the protein's likely zinc dependence

    • Stress conditions (pH changes, temperature shifts, oxidative stress) might induce expression if SCO5695 is involved in stress responses

    • Soil environmental factors could trigger expression if the protein has a role in environmental interactions

  • Experimental approaches to characterize regulation:

    • Reporter gene fusions (e.g., SCO5695 promoter driving luciferase or GFP expression)

    • Quantitative RT-PCR during different growth phases

    • Chromatin immunoprecipitation to identify transcription factors binding to the SCO5695 promoter

    • Proteomics to measure protein levels under different conditions

When studying SCO5695 regulation, researchers should consider using the S. coelicolor M145 strain, which is the reference strain used for genome sequencing . This strain shows advantageous antibiotic production and growth profiles compared to other laboratory strains like M600.

What are common challenges in working with recombinant SCO5695 and how can they be addressed?

Researchers working with recombinant SCO5695 may encounter several technical challenges:

  • Solubility issues:

    • Problem: Formation of inclusion bodies during expression

    • Solutions:

      • Lower induction temperature (16-18°C)

      • Reduce IPTG concentration

      • Use solubility-enhancing fusion tags (SUMO, MBP)

      • Consider refolding protocols if inclusion bodies persist

  • Protease activity:

    • Problem: Low or undetectable enzymatic activity

    • Solutions:

      • Ensure proper metal cofactor incorporation (add ZnCl₂ during purification)

      • Check pH optimum (test range 6.0-9.0)

      • Verify protein folding using circular dichroism

      • Test multiple substrate types as specificity may be narrow

  • Protein stability:

    • Problem: Degradation during storage

    • Solutions:

      • Add glycerol (50% final concentration) to storage buffer

      • Store at -80°C in small aliquots to avoid freeze-thaw cycles

      • Include protease inhibitors if necessary

      • Optimize buffer conditions (pH, ionic strength)

  • Functional verification:

    • Problem: Confirming that the recombinant protein reflects native function

    • Solutions:

      • Complement S. coelicolor SCO5695 deletion mutants

      • Compare activity profiles with native protein

      • Analyze post-translational modifications that might be missing

When reporting experimental challenges and solutions in publications, researchers should follow standard scientific writing guidelines, presenting data in well-structured tables and figures with clear explanations .

How can researchers distinguish between SCO5695 and other zinc metalloproteases in experimental settings?

Distinguishing SCO5695 from other zinc metalloproteases, particularly in complex biological samples or when studying homologous proteins, requires specific strategies:

  • Immunological approaches:

    • Generate SCO5695-specific antibodies for Western blotting, immunoprecipitation, or immunolocalization

    • Epitope mapping to identify unique regions for antibody generation

    • Use epitope tags (His, FLAG) for recombinant protein detection

  • Activity-based profiling:

    • Develop specific inhibitors or activity-based probes

    • Analyze cleavage site preferences to identify unique patterns

    • Use FRET-based substrates designed for SCO5695 specificity

  • Genetic approaches:

    • Gene knockout verification using PCR or Southern blotting

    • Complementation studies with wild-type and mutant versions

    • Gene tagging for in vivo localization and tracking

  • Mass spectrometry-based identification:

    • Proteotypic peptide identification for unambiguous detection

    • Multiple reaction monitoring (MRM) for specific detection in complex mixtures

    • Top-down proteomics for intact protein analysis

When analyzing paralogous zinc metalloproteases, researchers should be aware that sequence similarities in the catalytic domains might lead to cross-reactivity in antibody-based methods or overlap in substrate preferences. Therefore, multiple complementary approaches are recommended for definitive identification and characterization.

What are promising research avenues for understanding SCO5695's role in bacterial physiology?

Several promising research directions could advance our understanding of SCO5695's biological functions:

  • Systems biology approaches:

    • Integration of transcriptomics, proteomics, and metabolomics data from SCO5695 mutants

    • Network analysis to position SCO5695 within regulatory pathways

    • Comparative studies across multiple Streptomyces species to infer conserved functions

  • Structural biology:

    • Determination of SCO5695's three-dimensional structure through X-ray crystallography or cryo-EM

    • Structure-function analysis through site-directed mutagenesis of catalytic residues

    • Molecular dynamics simulations to understand substrate binding and catalysis

  • Ecological significance:

    • Investigation of SCO5695's role in interspecies interactions in soil environments

    • Examination of potential contributions to competitive fitness in microbial communities

    • Analysis of expression patterns in response to other soil microorganisms

  • Biotechnological applications:

    • Exploration of SCO5695 as a biocatalyst for specific peptide bond hydrolysis

    • Engineering SCO5695 variants with altered substrate specificity

    • Potential applications in protein processing or peptide synthesis

These research directions should ideally be pursued using the S. coelicolor M145 strain, which has been fully sequenced and is widely used as a model organism . This would facilitate integration of new findings with existing knowledge about Streptomyces biology.

How might comparative genomics inform our understanding of SCO5695 evolution and function?

Comparative genomics approaches offer powerful insights into the evolution and potential functions of SCO5695:

  • Evolutionary analysis:

    • Phylogenetic reconstruction of SCO5695 homologs across diverse bacterial taxa

    • Analysis of selective pressures (dN/dS ratios) to identify functionally important regions

    • Investigation of horizontal gene transfer events in SCO5695 distribution

  • Genome neighborhood analysis:

    • Examination of conserved gene clusters containing SCO5695 homologs

    • Identification of co-evolved genes that might function in the same pathway

    • Assessment of operon structures and potential co-regulation

  • Domain architecture comparison:

    • Analysis of domain shuffling events in SCO5695 evolution

    • Identification of lineage-specific adaptations in protein structure

    • Correlation of domain architecture with organismal lifestyle

  • Population genomics:

    • Examination of SCO5695 polymorphisms within Streptomyces populations

    • Assessment of intraspecies variation that might reflect functional diversification

    • Identification of potential adaptive mutations

When conducting comparative genomics studies, researchers should be aware that zinc metalloproteases have undergone multiple gene duplication events during bacterial evolution, as seen with the IgA1, ZmpB, ZmpC, and ZmpD paralogous family . This evolutionary history can complicate orthology assignments and functional predictions, requiring careful phylogenetic analysis and potentially supplemental experimental validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.