Recombinant Streptomyces coelicolor Sensor protein CutS (cutS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Streptomyces coelicolor Sensor Protein CutS (cutS)

Recombinant Streptomyces coelicolor Sensor Protein CutS (cutS) is a protein derived from the bacterium Streptomyces coelicolor, which is well-known for its ability to produce antibiotics and other secondary metabolites. The CutS protein is a sensor protein involved in regulatory pathways within the bacterium. It is expressed as a recombinant protein, often fused with a His-tag for purification purposes, and is used in various biochemical and biotechnological applications.

Characteristics of Recombinant CutS Protein

The recombinant CutS protein is typically expressed in Escherichia coli (E. coli) due to the ease of genetic manipulation and protein production in this host. Key characteristics of the recombinant CutS protein include:

CharacteristicsDescription
SpeciesStreptomyces coelicolor
SourceExpressed in E. coli
TagN-terminal His-tag
Protein LengthFull length (1-414 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt

Biological Function of CutS Protein

Sensor proteins like CutS play crucial roles in bacterial signal transduction pathways. They often act as part of two-component systems, where they sense environmental changes and trigger responses through their partner response regulators. The specific biological function of CutS in Streptomyces coelicolor is not extensively detailed in the literature, but it is likely involved in sensing and responding to environmental cues that affect the bacterium's growth, differentiation, or secondary metabolite production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your own protocols.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cutS; SCO5863; SC2E9.04; Sensor protein CutS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-414
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
cutS
Target Protein Sequence
MATTPAPPGAPPKPTWDPRSATPLPWLRPTIRIRLTLLYGGMFLIAGILLLSIIYLLAAQ AVRTGNEPLYKIVDFTDLKVSSSTCPVVDNGGLSLSDFNAAISDCMDHQRKVALDNLLSR SLLALLGLAVIAFAFGYAMAGRVLSPLGRITRTARAVAGSDLSRRIELDGPDDELKELAD TFDDMLERLQRAFTAQQRFVGNASHELRTPLAINRTLLEVHLSDPGAPVELQQLGKTLLA TNERSELLVEGLLLLARSDNQIVERKPVDLAEVAGQAIDQVHAEAESKGVEVRGTREAAV VQGNGVLLERIALNLVQNAVRYNVAGQGWVEVATAVENGQAVLVVTNTGPVVPAYEVDNL FEPFRRLRTERTGSDKGVGLGLSIARSVARAHGGHISAQPREGGGLVMRVTLPV
Uniprot No.

Target Background

Function
A member of the two-component CutS/CutR regulatory system, involved in copper metabolism regulation.
Database Links

KEGG: sco:SCO5863

STRING: 100226.SCO5863

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Streptomyces coelicolor Sensor protein CutS?

CutS is a transmembrane sensor histidine kinase that forms part of the CutRS two-component system in Streptomyces bacteria. The full-length protein consists of 414 amino acids (P0A4I7) with a molecular structure that includes an extracellular sensor domain positioned between two transmembrane helices, followed by cytoplasmic signaling domains .

Functionally, CutS mediates the secretion stress response, monitoring the external environment to detect conditions that might affect protein folding. When activated, it triggers phosphorylation of its cognate response regulator CutR, which subsequently modulates the expression of genes involved in the stress response, particularly those encoding HtrA-family chaperones/proteases .

What are the optimal conditions for recombinant expression of CutS protein?

For optimal recombinant expression of the CutS protein:

  • Expression System: E. coli is the recommended host system for recombinant production, with His-tagged constructs showing good expression levels .

  • Protein Recovery: After expression, the protein should be purified using affinity chromatography and supplied as a lyophilized powder to maintain stability .

  • Reconstitution Protocol:

    • Briefly centrifuge the protein vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Aliquot for long-term storage at -20°C/-80°C

  • Storage Considerations:

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

    • Long-term storage requires -20°C/-80°C in buffer with 50% glycerol

How can researchers effectively mutate the conserved cysteine residues in CutS to study their function?

To effectively mutate the conserved cysteine residues in CutS for functional studies:

  • Site-Directed Mutagenesis Approach:

    • Design primers to replace the conserved cysteine codons with serine codons (as successfully demonstrated with the CutS(C85S,C103S) variant)

    • Use PCR-based site-directed mutagenesis methods to introduce the desired mutations

    • Confirm mutations by DNA sequencing before expression

  • Scanning Mutagenesis Alternative:

    • For more comprehensive analysis, consider scanning mutagenesis to systematically replace the cysteines and neighboring residues

    • This approach allows for detailed structure-function analysis of the sensor domain

  • Validation Methods:

    • Perform complementation assays by introducing the mutant constructs into ΔcutRS strains

    • Measure the expression of known CutR target genes (e.g., htrA3 and htrB) using qRT-PCR

    • Compare growth phenotypes between wild-type, deletion mutants, and complemented strains

How does the CutS protein sense the extracellular redox state through its conserved cysteine residues?

CutS employs a sophisticated mechanism for sensing extracellular redox conditions through its conserved cysteine residues:

  • Disulfide Bond Formation: The two invariant cysteine residues in the extracellular sensor domain (positioned approximately 5Å apart based on AlphaFold modeling) likely form a disulfide bond under oxidizing conditions .

  • Sensing Mechanism: Research indicates that the formation or disruption of this disulfide bond serves as a molecular switch that controls CutS activity. When the extracellular environment prevents disulfide bond formation (reducing conditions), CutS becomes activated .

  • Experimental Evidence: Substituting both cysteines with serines (CutS(C85S,C103S) in S. venezuelae) creates a constitutively active variant that cannot form disulfide bonds. This mutant exhibits increased expression of htrA3 and stronger repression of htrB compared to wild-type CutS, suggesting that the inability to form disulfide bonds outside the cell activates the CutRS system .

  • Physiological Relevance: This mechanism allows bacteria to detect conditions that might interfere with proper disulfide bond formation in secreted proteins, triggering appropriate stress responses. Since 74% of Sec-translocated proteins in S. venezuelae contain two or more cysteines, this system likely monitors the proper folding of numerous secreted proteins .

What is the relationship between the CutRS and CssRS two-component systems in regulating the secretion stress response?

The CutRS and CssRS systems exhibit a complex, interconnected relationship in regulating secretion stress response:

  • Complementary Regulation:

    • CutRS controls the expression of htrA3 (activation) and htrB (repression)

    • CssRS activates the expression of htrA1, htrA2, and htrB

    • Together, they regulate all four conserved HtrA-family chaperones

  • Opposing Roles:

    • Deletion of cssRS in a ΔcutRS background restores wild-type growth, suggesting that these systems may play opposing or balancing roles

    • CssRS is overexpressed in the ΔcutRS mutant, indicating potential compensatory mechanisms

  • Shared Sensing Mechanism:

    • Like CutS, CssS also contains two conserved cysteine residues in its extracellular sensor domain

    • These are the only two conserved Streptomyces sensor kinases with this feature

    • This suggests both systems monitor disulfide bond formation in secreted proteins, possibly responding to different aspects of the same physiological process

SystemPrincipal Target GenesActivatesRepressesConserved Cysteines
CutRShtrA3, htrBhtrA3htrB2 (100% conserved)
CssRShtrA1, htrA2, htrBAll threeNone reported2 (100% conserved)

How conserved is the CutS protein across bacterial species and what does this reveal about its importance?

The conservation pattern of CutS across bacteria reveals significant insights about its evolutionary importance:

What is the molecular basis for CutR binding to target promoters and how does it regulate gene expression?

The molecular basis of CutR binding and gene regulation has been elucidated through detailed experimental analysis:

  • Binding Sequence Recognition:

    • CutR binds to a consensus sequence identified as TAWATAAA in promoter regions

    • This sequence was confirmed through Surface Plasmon Resonance (SPR) experiments with purified CutR protein

  • Position-Dependent Regulation:

    • The location of the CutR binding sequence relative to the transcription start site (TSS) determines whether CutR activates or represses transcription

    • When bound closer to the TSS, CutR typically activates gene expression (as with htrA3)

    • When bound at greater distances from the TSS, CutR tends to repress gene expression (as with htrB)

  • Regulon Composition:

    • The core CutR regulon is conserved between distantly related Streptomyces species

    • In S. venezuelae, CutR directly regulates at least seven genes, with its primary targets being htrA3 (activation) and htrB (repression)

    • Other targets include vnz_08815, which encodes a cell wall amidase of unknown function

  • Regulatory Mechanism:

    • CutS detects redox stress via its extracellular cysteines

    • Upon activation, CutS phosphorylates CutR

    • Phosphorylated CutR binds to target promoters containing the TAWATAAA sequence

    • This binding modulates RNA polymerase recruitment and activity, resulting in either activation or repression of target genes

What are common challenges in working with recombinant CutS protein and how can they be addressed?

Researchers working with recombinant CutS protein frequently encounter several challenges:

  • Protein Solubility and Stability Issues:

    • Challenge: As a membrane protein with transmembrane domains, CutS can have solubility issues.

    • Solution: Express with solubility-enhancing tags (His-tag is effective); use mild detergents during purification; add 6% trehalose to storage buffer to enhance stability .

  • Maintaining Native Conformation:

    • Challenge: Preserving the native disulfide bond arrangement in the sensor domain.

    • Solution: Carefully control redox conditions during purification; avoid strong reducing agents when studying the protein's sensor function; consider using oxidizing conditions to promote proper disulfide bond formation .

  • Freeze-Thaw Degradation:

    • Challenge: Protein functionality loss through repeated freeze-thaw cycles.

    • Solution: Store in small aliquots with 50% glycerol; maintain working aliquots at 4°C for up to one week; avoid multiple freeze-thaw cycles .

  • Functional Assays:

    • Challenge: Demonstrating sensor kinase activity in vitro.

    • Solution: Develop assays that can detect phosphotransfer to CutR; consider reconstituting the protein in liposomes to maintain its native membrane environment for functional studies .

How can researchers effectively distinguish between CutS and CssS functions in vivo when both systems are present?

Distinguishing between CutS and CssS functions in vivo requires strategic experimental approaches:

  • Genetic Manipulation Strategies:

    • Create single (ΔcutRS or ΔcssRS) and double (ΔcutRS ΔcssRS) deletion mutants

    • Develop complementation strains with wild-type or mutated versions of either system

    • Use inducible promoters to control expression levels of each system independently

  • Reporter Systems:

    • Develop promoter-reporter fusions for specific target genes (htrA1, htrA2, htrA3, and htrB)

    • Monitor expression changes in response to various stress conditions across the different mutant backgrounds

    • This allows visualization of which system responds to particular stresses

  • Specific Stress Induction:

    • Apply different protein secretion stresses (protein overexpression, misfolding agents)

    • Test redox-specific stresses (oxidizing/reducing agents) to differentiate responses

    • Examine environmental stresses relevant to the natural habitat (soil conditions)

  • Biochemical Approaches:

    • Perform chromatin immunoprecipitation (ChIP) with tagged versions of CutR and CssR

    • Use quantitative proteomics to monitor changes in the abundance of all four HtrA-family proteins

    • Analyze phosphorylation states of CutR and CssR under different conditions

What are the most promising applications of CutS research in understanding bacterial stress responses?

Several promising research directions emerge from current understanding of CutS:

  • Bacterial Adaptation to Environmental Change:

    • Investigate how CutS-mediated sensing helps Streptomyces adapt to fluctuating soil redox conditions

    • Explore how this system contributes to ecological fitness in natural environments

    • Develop models of how two-component systems enable rapid bacterial adaptation

  • Protein Secretion Engineering:

    • Leverage CutS/CssS knowledge to improve heterologous protein secretion in Streptomyces

    • Develop strains with modified secretion stress responses for enhanced protein production

    • Engineer sensor domains with altered sensitivity for biotechnological applications

  • Antimicrobial Development:

    • Target the CutRS/CssRS systems to disrupt bacterial adaptation to host environments

    • Develop compounds that interfere with disulfide bond formation in sensor domains

    • Create broad-spectrum approaches based on the finding that 98.9% of bacterial strains have redox-sensing kinases

  • Synthetic Biology Applications:

    • Design synthetic sensors based on the CutS extracellular domain to detect specific redox conditions

    • Create engineered signaling cascades using modular components of these systems

    • Develop biosensors for environmental monitoring based on CutS sensing principles

What methodological innovations could advance our understanding of CutS function and regulation?

Several methodological innovations could significantly advance CutS research:

  • Structural Biology Approaches:

    • Determine the high-resolution structure of CutS in different oxidation states

    • Use cryo-electron microscopy to visualize the complete CutRS signaling complex

    • Apply hydrogen-deuterium exchange mass spectrometry to map conformational changes during sensing

  • Advanced Genetic Tools:

    • Apply CRISPR-Cas9 for precise genome editing to introduce subtle mutations

    • Develop conditional depletion systems to study essential aspects of CutS function

    • Create libraries of sensor domain variants using unnatural amino acid mutagenesis to probe mechanism details

  • Systems Biology Integration:

    • Apply multi-omics approaches (transcriptomics, proteomics, metabolomics) to comprehensively map CutRS-dependent responses

    • Develop mathematical models of the interconnected CutRS and CssRS systems

    • Use network analysis to position these systems within the broader stress response network

  • Real-time Sensing Visualization:

    • Develop FRET-based sensors to visualize CutS activation in real-time

    • Create biosensors that report on the redox state of the extracellular environment

    • Apply microfluidics to precisely control and alter redox conditions while monitoring responses

  • Synthetic Biology Tools:

    • Engineer chimeric sensor domains with altered specificity

    • Create orthogonal two-component systems based on CutS/CutR architecture

    • Develop tunable CutS variants that respond to specific redox signals

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.