Recombinant Streptomyces coelicolor Ubiquinol-cytochrome c reductase iron-sulfur subunit (qcrA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
qcrA; SCO2149; SC6G10.22c; Cytochrome bc1 complex Rieske iron-sulfur subunit; Cytochrome bc1 reductase complex subunit QcrA; Rieske iron-sulfur protein; Ubiquinol--cytochrome c reductase iron-sulfur subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
qcrA
Target Protein Sequence
MSSQDIPEENLPAEQDRPHGAAARPADETNPFADPGLPPHEPRVQDVDERAAKRSERTVA LLFTLSMLATIAFIAAFVAIDVDKSVYIFPLGHISALNFALGMTLGVALFAIGAGAVHWA RTLMSDEEVADERHPIEASPEVRAKVHADFKQGAKESVIGRRKLIRNTMLGALTLVPLSG VVLLRDLGPLPGTKLRHTLWSKGKLLVNMNTNEPLRPSDVAVGSLTFAMPEGLEEHDEDF QNEIAKAALMIIRLEPDSIKDKRELEWSHEGIVAYSKICTHVGCPISLYEQQTHHALCPC HQSTFDLADGARVIFGPAGHALPQLRIGVNDEGYLEALGDFEEPVGPAYWERG
Uniprot No.

Target Background

Function

The iron-sulfur subunit of the cytochrome bc1 complex is a crucial component of the respiratory electron transport chain, essential for ATP synthesis. This complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c, operating via a Q-cycle mechanism. This mechanism couples electron transfer to proton gradient generation, driving ATP synthesis.

Database Links

KEGG: sco:SCO2149

STRING: 100226.SCO2149

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is qcrA in Streptomyces coelicolor and what is its role in bacterial metabolism?

The qcrA gene (SCO2149) in Streptomyces coelicolor encodes the Ubiquinol-cytochrome c reductase iron-sulfur subunit, also known as the Rieske iron-sulfur protein. This protein is a critical component of the cytochrome bcc-aa3 oxidase supercomplex in the respiratory chain of S. coelicolor . The protein contains a [2Fe-2S] center and plays an essential role in electron transfer during respiration.

In S. coelicolor, the bcc-aa3 supercomplex has a linear supramolecular organization comprising a complex III (bcc complex) dimer flanked at each end by an aa3 oxidase (complex IV) . Unlike mitochondria and many oxidase-positive bacteria that use a soluble cytochrome c to shuttle electrons between complexes III and IV, actinobacteria like S. coelicolor have a membrane-anchored diheme cytochrome c (QcrC), which necessitates direct contact between complexes III and IV for electron transfer to occur .

How does qcrA structurally interact with other respiratory components?

The qcrA protein functions as part of a larger respiratory complex. Based on structural studies in related actinobacteria like Mycobacterium smegmatis, the bcc-aa3 supercomplex containing qcrA has a distinct organization where:

  • qcrA (iron-sulfur protein) interacts with QcrB (cytochrome b) and QcrC (cytochrome c1) to form the cytochrome bcc complex

  • This complex then associates with cytochrome aa3 oxidase components

  • The qcrA subunit is positioned to accept electrons from menaquinol and transfer them to cytochrome c1

In S. coelicolor, co-purification studies have shown that qcrA can be isolated along with other components of the bcc-aa3 supercomplex, specifically QcrB and CtaE (cytochrome aa3 oxidase subunit III), suggesting direct protein-protein interactions .

What are the optimal methods for expressing recombinant qcrA protein?

Several expression systems have been used successfully for producing recombinant qcrA:

  • Cell-free expression systems: These have been used to produce recombinant qcrA with greater than 85% purity as determined by SDS-PAGE .

  • Heterologous expression hosts: Various hosts including E. coli, yeast, baculovirus, and mammalian cell systems have been utilized for qcrA expression .

When expressing qcrA, researchers should consider:

  • Including appropriate signal sequences if membrane insertion is required

  • Incorporating purification tags (the tag type is often determined during the production process to optimize yield and activity)

  • Storage conditions: recommended in Tris-based buffer with 50% glycerol at -20°C, with avoidance of repeated freeze-thaw cycles

How can researchers effectively study qcrA interactions with respiratory complexes?

To investigate qcrA interactions with respiratory complexes, several approaches have proven effective:

  • Co-purification studies: As demonstrated in research with S. coelicolor, using Strep-tagged variants of respiratory components allows for isolation of protein complexes and identification of interacting partners by mass spectrometry .

  • Clear native polyacrylamide gel electrophoresis: This technique enabled researchers to identify two differentially migrating active Nar1 complexes that co-purified with respiratory components including qcrA, with masses of approximately 450 and 250 kDa .

  • Mass spectrometry analysis: After co-purification, mass spectrometry can identify interacting proteins as shown in this data table from studies of respiratory complexes in S. coelicolor:

SCO numberEnzyme/proteinDescriptionPeptidesPSMsMass [kDa]
SCO2148QcrBCytochrome b component1560.8
SCO2149QcrAUbiquinol-cytochrome c reductase iron-sulfur subunit1222.7
SCO7236QcrB3Probable cytochrome b subunit1261.4

Table adapted from data in search result

How does qcrA function differ between developmental stages of S. coelicolor?

S. coelicolor undergoes a complex developmental cycle involving different mycelial structures (MI, first compartmentalized mycelium; MII, second multinucleated mycelium) and the formation of spores . Research indicates that:

  • The composition of the bcc-aa3 supercomplex containing qcrA differs between spores and mycelium in S. coelicolor .

  • In spores, QcrB (the standard cytochrome b component that interacts with qcrA) is significantly less abundant than in mycelium .

  • An alternative cytochrome b paralog, QcrB3 (SCO7236), may be specifically synthesized in spores and functionally substitute for QcrB in interactions with qcrA .

This developmental regulation suggests that qcrA may function within different respiratory complex assemblies depending on the stage of the S. coelicolor life cycle.

What research methodologies are appropriate for studying qcrA expression regulation?

To study qcrA expression regulation, researchers have employed several complementary approaches:

  • RT-PCR analysis: This technique allows for the measurement of qcrA transcript levels under different growth conditions . Similar to methodology used for other S. coelicolor genes, cells can be grown in appropriate media (e.g., tryptic soy broth without dextrose, with or without specific carbon sources) before RNA extraction and analysis .

  • Transcriptomic analysis: Microarray or RNA-seq approaches can provide comprehensive analysis of qcrA expression in relation to other genes. For example, 2D-DIGE/nanoLC-ESI-LIT-MS/MS has been used to analyze proteome changes in S. coelicolor .

  • Promoter fusion studies: Fusing the qcrA promoter region to reporter genes can help identify regulatory elements controlling its expression.

  • Proteomic analysis: 2D gel electrophoresis coupled with mass spectrometry allows quantification of qcrA protein levels under different conditions .

How can researchers design effective qcrA knockout or mutation experiments?

For genetic manipulation of qcrA in S. coelicolor, several approaches have proven successful:

  • Targeted gene knockout: Using homologous recombination with a disruption cassette containing an antibiotic resistance marker. This approach has been successfully used for other genes in S. coelicolor .

  • Site-specific recombination systems: A system using RsA and RsB recombination sites along with the ZouA relaxase has been employed for genetic manipulation in S. coelicolor . This system could be adapted for qcrA studies.

  • CRISPR-Cas9 gene editing: While not specifically mentioned for qcrA in the search results, CRISPR-based approaches have been applied to Streptomyces species and offer precise gene editing capabilities.

When designing qcrA mutants, researchers should consider:

  • The potential essentiality of qcrA for viability

  • Possible polar effects on downstream genes

  • The creation of conditional mutants if complete deletion is lethal

What methodological approaches are effective for resolving contradictory findings about qcrA function?

When facing contradictory results regarding qcrA function, researchers should consider these methodological approaches:

  • Quasi-experimental design research: This approach is particularly valuable when complete randomization is not feasible, as is often the case in bacterial genetics studies . Key elements include:

    • Pre-post designs with non-equivalent control groups

    • Interrupted time series analysis

    • Stepped wedge designs

  • Mixed-method approaches: Combining quantitative measurements (e.g., growth rates, enzyme activities) with qualitative assessments (e.g., morphological changes) can provide a more comprehensive understanding of qcrA function .

  • Systematic validation using multiple strains/conditions: Test hypotheses across different genetic backgrounds and growth conditions to identify context-dependent effects.

  • Use of tabular data organization: As shown in research methodology literature, properly structured tables can enhance trustworthiness in research findings :

Table typeContributing to ensuring trustworthiness
Data inventory tableHelps researchers ensure they have collected all data required by their study design
Cross-case comparative tableFacilitates systematic and thorough comparisons across experimental conditions
Temporally ordered tableFacilitates systematic tracking of empirical support for claimed temporal patterns

How does qcrA function relate to antibiotic production in S. coelicolor?

S. coelicolor is known for producing several antibiotics, including actinorhodin (ACT), undecylprodigiosin, and calcium-dependent antibiotic (CDA) . Research suggests complex relationships between respiratory function and antibiotic production:

  • The respiratory chain, including components like qcrA, influences cellular redox balance and energy generation, which can affect secondary metabolite production pathways.

  • Studies with other genes in S. coelicolor have shown that manipulation of respiratory components can significantly impact antibiotic production. For example, the small ORF trpM influences both growth and ACT production .

  • Metabolic engineering approaches targeting respiratory components could potentially enhance antibiotic production. For instance, amplification of the act gene cluster (responsible for actinorhodin biosynthesis) has been achieved using site-specific recombination systems in S. coelicolor .

What are the most effective experimental designs for studying qcrA's role in adaptation to different electron acceptors?

To investigate how qcrA contributes to adaptation to different electron acceptors, researchers should consider:

  • Growth studies under varying respiratory conditions: Compare growth rates with different electron acceptors (O2, nitrate, TMAO) in wild-type versus qcrA mutant strains. Research in related bacteria has shown that qcrABC deletion mutants are completely deficient in oxygen-limited growth on nitrate and TMAO .

  • Measurement of electron transfer rates: Quantify electron transfer through the respiratory chain using biochemical assays with different electron donors and acceptors.

  • Adaptive laboratory evolution: Subject S. coelicolor to growth under selective pressure with alternative electron acceptors, followed by genomic and transcriptomic analysis to identify adaptations in qcrA and related genes.

  • Comparative genomic approaches: Compare qcrA sequence and function across bacterial species adapted to different ecological niches. For example, while qcrA functions in the context of the bcc-aa3 supercomplex in S. coelicolor, in Campylobacter jejuni the qcrABC complex plays a crucial role in periplasmic nitrate and TMAO respiration .

How can advanced quantitative methodologies enhance our understanding of qcrA function?

Advanced quantitative methodologies can significantly enhance qcrA research:

  • Multilevel modeling techniques: These can help analyze complex data structures resulting from experimental designs with multiple variables affecting qcrA function .

  • Systems biology approaches: Integrating transcriptomic, proteomic, and metabolomic data can provide a comprehensive view of how qcrA functions within the broader metabolic network of S. coelicolor.

  • Computational modeling of electron transfer: Quantitative modeling of electron flow through respiratory complexes can predict the effects of qcrA mutations or altered expression levels.

  • Statistical analysis of experimental data: Applying rigorous statistical methods can help distinguish significant effects from experimental noise, particularly important when studying subtle phenotypes in qcrA mutants .

What are the emerging technologies that could advance qcrA research?

Several emerging technologies show promise for advancing qcrA research:

  • Cryo-electron microscopy: This technique can provide high-resolution structural information about qcrA within its native respiratory complex .

  • Single-molecule imaging techniques: These approaches could visualize electron transfer through individual respiratory complexes containing qcrA.

  • CRISPR interference (CRISPRi): This technology allows for tunable repression of gene expression, enabling the study of essential genes like qcrA without complete deletion.

  • Microfluidic cultivation systems: These systems permit precise control of growth conditions and real-time monitoring of bacterial responses, ideal for studying qcrA function under dynamically changing environmental conditions.

  • Synthetic biology approaches: Engineering synthetic respiratory chains with modified qcrA variants could provide insights into structure-function relationships and potentially enhance electron transfer efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.