Recombinant Streptomyces coelicolor Undecaprenyl-diphosphatase 2 (uppP2)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Undecaprenyl-diphosphatase 2 (uppP2) belongs to a family of enzymes responsible for the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP). In Streptomyces coelicolor, this enzyme is specifically classified as a UDP pyrophosphate phosphatase . The enzyme plays a crucial role in the bacterial cell wall synthesis pathway, particularly in the recycling phase of the lipid carrier molecule. Undecaprenyl-diphosphatases are typically membrane-associated proteins due to their function in processing lipid substrates that are embedded in the bacterial cell membrane. The catalytic activity of these enzymes is essential for maintaining the pool of available UP molecules, which serve as carriers for cell wall building blocks.

Historical Context of Discovery

The identification and characterization of undecaprenyl-diphosphatases became significant as researchers recognized the importance of the lipid II cycle in bacterial survival and the potential for targeting these pathways for antibiotic development. The understanding of these enzymes evolved alongside advances in bacterial genetics and biochemistry. Research on related UPP phosphatases in other bacterial species, such as BcrC and UppP in Bacillus subtilis, has provided valuable insights into the function and importance of these enzymes . These studies have established the critical role of UPP phosphatases in connecting cell wall homeostasis with cell envelope stress responses, highlighting their significance in bacterial physiology.

Relationship to Other Bacterial Enzymes

Undecaprenyl-diphosphatase 2 operates within a complex network of enzymes involved in cell wall biosynthesis. It functions in conjunction with undecaprenyl pyrophosphate synthase (UppS), which is responsible for the de novo synthesis of UPP . While UppS catalyzes the formation of UPP, uppP2 catalyzes its dephosphorylation to UP, creating a balanced system for maintaining appropriate levels of the lipid carrier. This balance is crucial because UP represents the central bottleneck for the synthesis of lipid II, a key intermediate in peptidoglycan synthesis, both in vitro and in vivo . Additionally, UP can also be generated through phosphorylation of undecaprenol by kinases such as DgkA in some bacterial species, providing an alternative pathway for replenishing the UP pool .

Molecular Properties

Recombinant Streptomyces coelicolor Undecaprenyl-diphosphatase 2 likely shares structural similarities with other bacterial UPP phosphatases. Related enzymes, such as undecaprenyl pyrophosphate synthase from Escherichia coli, have been reported to have a molecular mass of approximately 29 kDa . The enzyme's structure would necessarily include catalytic domains responsible for the phosphatase activity that removes a phosphate group from undecaprenyl pyrophosphate. The specific arrangement of these domains and the presence of membrane-interacting regions would be essential for the enzyme's function, allowing it to access its lipid substrate within the bacterial membrane environment.

Gene Structure and Expression

The gene encoding Streptomyces coelicolor Undecaprenyl-diphosphatase 2 is known by multiple designations: uppP2, uppP, bacA2, upk2, and 2SCG61.08 . This diversity in nomenclature may reflect the gene's identification by different research groups or its relationship to similar genes in other bacterial species. Studies on related UPP phosphatases in Bacillus subtilis have shown that their expression is maintained at high levels from early exponential to late stationary phase, with some variation during transitional states . Additionally, the expression of some UPP phosphatases, such as BcrC in B. subtilis, can be increased in response to antibiotics like bacitracin, suggesting a role in stress response mechanisms .

Protein Purification and Analysis

The recombinant form of Streptomyces coelicolor Undecaprenyl-diphosphatase 2 is produced using cell-free expression systems, which allow for efficient production of the protein without the complications of cellular toxicity that might arise from overexpression of membrane-associated proteins . Following expression, the protein is purified to a high level of homogeneity, with purity greater than or equal to 85% as determined by SDS-PAGE analysis . This high-quality purification is essential for accurate biochemical characterization and potential structural studies of the enzyme. The use of cell-free expression systems represents an advanced approach to producing membrane proteins, bypassing many of the challenges associated with traditional in vivo expression methods.

Role in Cell Wall Biosynthesis

In Streptomyces coelicolor, as in other bacteria, undecaprenyl-diphosphatase 2 plays a crucial role in cell wall biosynthesis by facilitating the recycling of the lipid carrier undecaprenyl phosphate (UP). The bacterial cell wall synthesis pathway begins with the assembly of cell wall precursors on the cytoplasmic side of the membrane, using UP as a carrier molecule . Each bacterial cell contains approximately 2×10^5 UP molecules, representing only 0.5-1% of all phospholipids, yet these carriers must shuttle one to three cell wall building blocks per second during exponential growth . This high turnover rate necessitates efficient recycling of UP, a process in which uppP2 plays a central role by dephosphorylating UPP to regenerate UP.

The Lipid II Cycle

The lipid II cycle represents the core process in bacterial cell wall biosynthesis, and undecaprenyl-diphosphatase 2 is a key component of this cycle. The cycle begins with the addition of UDP-N-acetylglucosamine (GlcNAc) and UDP-N-acetylmuramic acid (MurNAc)-pentapeptide to UP on the cytoplasmic side of the bacterial membrane . The resulting lipid II molecule is then flipped across the membrane by specific flippases . On the exterior side, the cell wall building block is incorporated into the existing cell wall through transglycosylation and transpeptidation reactions, releasing UPP . At this point, uppP2 catalyzes the dephosphorylation of UPP to UP, which is then flipped back to the cytoplasmic leaflet to restart the cycle . This continuous cycling is essential for maintaining cell wall synthesis during bacterial growth.

Relationship to Bacterial Survival and Growth

The function of undecaprenyl-diphosphatase 2 is directly tied to bacterial survival and growth, as proper cell wall synthesis is essential for maintaining cellular integrity and division. Research on related UPP phosphatases in Bacillus subtilis has shown that depletion of these enzymes leads to synthetic lethality and severe morphological defects . The importance of these enzymes is further underscored by the observation that certain antibiotics target the lipid II cycle, exploiting the bottleneck in UP availability to inhibit cell wall synthesis . By disrupting the function of enzymes like uppP2, these antibiotics can lead to the accumulation of intermediates, shortage of free carrier molecules, and ultimately impaired cell wall biosynthesis resulting in bacterial death .

Recombinant Expression Systems

The production of Recombinant Streptomyces coelicolor Undecaprenyl-diphosphatase 2 utilizes cell-free expression systems, which represent an advanced approach to protein production . This method involves the use of cellular extracts containing transcription and translation machinery but lacks intact cell membranes, allowing for the direct synthesis of proteins without cellular compartmentalization constraints. Cell-free expression is particularly advantageous for membrane-associated proteins like phosphatases, as it circumvents potential toxicity issues associated with overexpression in bacterial hosts and provides a controlled environment for protein folding and solubilization.

Purification Techniques

While specific purification techniques for Streptomyces coelicolor uppP2 are not detailed in the available information, standard methods for similar proteins often involve multiple chromatography steps. Related studies on undecaprenyl pyrophosphate synthase from E. coli employed techniques such as TSK-DEAE, ceramic hydroxyapatite, TSK-ether, Superdex 200, and heparin-Actigel chromatography . For recombinant proteins expressed with affinity tags, such as His-tags, affinity chromatography provides an efficient purification approach. The specific purification strategy would be optimized based on the physical and chemical properties of the recombinant uppP2 enzyme, including its solubility, stability, and interaction with different chromatographic matrices.

Quality Assessment

The quality of purified Recombinant Streptomyces coelicolor Undecaprenyl-diphosphatase 2 is assessed using SDS-PAGE analysis, with the enzyme demonstrating purity levels greater than or equal to 85% . This analytical technique allows for the visualization of protein bands and assessment of purity based on the presence of contaminant bands. The high purity level achieved is indicative of effective expression and purification protocols. Beyond SDS-PAGE, comprehensive quality assessment would typically include additional techniques such as mass spectrometry for molecular weight confirmation, enzymatic activity assays to verify function, and stability studies to determine optimal storage conditions.

Functional Conservation Across Species

The function of undecaprenyl-diphosphatase appears to be conserved across various bacterial species, reflecting the fundamental importance of the lipid II cycle in bacterial cell wall biosynthesis. Studies in Bacillus subtilis have shown that UPP phosphatases like BcrC and UppP form an essential pair that connects cell wall homeostasis with the cell envelope stress response . The presence of similar enzymes in diverse bacteria, including Streptomyces coelicolor, Rhizobium loti, Agrobacterium tumefaciens, and Clostridium difficile , underscores the evolutionary conservation of this enzymatic function. This functional conservation likely reflects the critical role of these enzymes in maintaining the pool of UP molecules necessary for cell wall synthesis.

Evolutionary Significance

The conservation of undecaprenyl-diphosphatase function across bacterial species highlights its evolutionary significance in bacterial survival. The enzyme's role in the essential process of cell wall synthesis has likely placed selective pressure for the maintenance of functional phosphatase activity despite potential sequence divergence. The multiple gene names associated with Streptomyces coelicolor uppP2 (uppP2, uppP, bacA2, upk2, 2SCG61.08) may reflect this evolutionary history, possibly indicating gene duplication events or horizontal gene transfer between bacterial species. This evolutionary conservation underscores the fundamental importance of the lipid II cycle in bacterial physiology and the central role of UPP phosphatases in this process.

Antibiotic Development Targets

Given the essential role of undecaprenyl-diphosphatase 2 in bacterial cell wall synthesis, this enzyme represents a potential target for antibiotic development. Antibiotics that target the lipid II cycle can exploit the bottleneck in UP availability, leading to the accumulation of intermediates, shortage of free carrier molecules, and impaired cell wall biosynthesis . The specificity of bacterial UPP phosphatases and their absence in human cells make them attractive targets for selective antibacterial agents. Understanding the structure and function of uppP2 in Streptomyces coelicolor could inform the design of specific inhibitors that disrupt cell wall synthesis in pathogenic bacteria with similar enzymatic machinery, potentially addressing the growing challenge of antibiotic resistance.

Biotechnological Applications

Beyond its relevance to antibiotic development, undecaprenyl-diphosphatase 2 may have potential applications in biotechnology. The enzyme's ability to process complex lipid substrates could be harnessed for the synthesis or modification of bioactive compounds. Engineering bacteria with modified or enhanced UPP phosphatase activity could potentially improve the production of certain secondary metabolites or facilitate the incorporation of non-natural building blocks into bacterial cell walls. Additionally, the development of high-throughput assays for UPP phosphatase activity could facilitate screening for novel modulators of these enzymes, with applications in both basic research and drug discovery.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this requirement in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it for your request.
Synonyms
uppP2; bacA2; upk2; SCO1326; 2SCG61.08; Undecaprenyl-diphosphatase 2; Bacitracin resistance protein 2; Undecaprenyl pyrophosphate phosphatase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
uppP2
Target Protein Sequence
MSWFESLVLGLVQGLTEFLPVSSSAHLRLTAAFSGWHDPGAAFTAITQIGTEAAVLIYFR KDIGRIIAAWTRSLTDKSMRHDPDARMGWLVIVGSIPIGVLGLTLKDQIEGPFRDLRITA TMLIVVGVIIGIADRMAARDEKGGRHRAPQQRKELENLGVRDGLIYGLCQAAALIPGVSR SGATISGGLFMGYRREAAARYSFLLAIPAVLASGVFELKDAMESDHVSWGPTLFATVIAF ATGYVVIAWFMKFISTKSFMPFVWYRIALGIVIIVLVSVGVLSPHAAESGG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: sco:SCO1326

STRING: 100226.SCO1326

Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase 2 and what is its role in Streptomyces coelicolor?

Undecaprenyl-diphosphatase 2 (uppP2) is an enzyme (EC 3.6.1.27) involved in bacterial cell wall biosynthesis. In Streptomyces coelicolor, it functions as a UDP pyrophosphate phosphatase and is also known by several alternate gene names including uppP, bacA2, upk2, and 2SCG61.08 . The enzyme plays a critical role in peptidoglycan synthesis by recycling the lipid carrier undecaprenyl phosphate. Specifically, it dephosphorylates undecaprenyl pyrophosphate to generate undecaprenyl phosphate, which is essential for the transport of peptidoglycan precursors across the cytoplasmic membrane during cell wall formation.

How is recombinant Streptomyces coelicolor uppP2 typically produced and purified?

Recombinant Streptomyces coelicolor uppP2 is typically produced using cell-free expression systems, which allow for rapid protein production without the limitations associated with traditional cell-based expression methods . The purification process typically involves affinity chromatography followed by size-exclusion chromatography to achieve a purity of greater than or equal to 85% as determined by SDS-PAGE analysis . Researchers should verify protein identity through mass spectrometry and assess enzyme activity using appropriate phosphatase assays with undecaprenyl pyrophosphate as substrate.

What expression systems are most effective for producing functional recombinant Streptomyces coelicolor uppP2?

While cell-free expression systems appear to be the preferred method for producing recombinant Streptomyces coelicolor uppP2 according to available commercial sources , researchers should consider several expression platforms based on their specific experimental requirements. E. coli-based expression systems are commonly used for basic structural and functional studies, whereas more complex eukaryotic systems like yeast, baculovirus, or mammalian cell expression may be preferred when post-translational modifications or proper protein folding are concerns . Each system offers distinct advantages regarding yield, solubility, and biological activity of the recombinant enzyme.

How should researchers design experiments to assess uppP2 enzymatic activity?

To properly assess uppP2 enzymatic activity, researchers should employ a multi-faceted approach that includes both direct and indirect activity assays. A recommended protocol involves monitoring the release of inorganic phosphate from undecaprenyl pyrophosphate substrate using malachite green or similar colorimetric methods. Reaction conditions should include appropriate buffers (typically HEPES or Tris at pH 7.5-8.0), divalent cations (usually Mg²⁺ or Mn²⁺), and varying substrate concentrations to determine kinetic parameters.

For more rigorous analysis, researchers should perform substrate specificity studies comparing undecaprenyl pyrophosphate with other related lipid pyrophosphates, and conduct inhibition studies using known phosphatase inhibitors. All experiments should include appropriate negative controls (heat-inactivated enzyme) and positive controls (commercially available phosphatases with known activity).

What are the optimal conditions for studying uppP2 interactions with potential inhibitors?

When investigating uppP2 interactions with potential inhibitors, researchers should first establish a robust and reproducible activity assay as described above. Thermal shift assays can provide initial screening data on compound binding, while enzyme kinetics studies should be performed to determine inhibition mechanisms (competitive, non-competitive, or uncompetitive). Optimal conditions typically include:

  • Buffer composition: 50 mM HEPES or Tris, pH 7.5-8.0

  • Salt concentration: 100-150 mM NaCl

  • Temperature: 25-30°C (reflecting S. coelicolor growth conditions)

  • Incubation time: Sufficient to observe linear reaction rates

  • Detection method: Malachite green for phosphate release or HPLC for substrate/product analysis

Researchers should consider using structure-based approaches if structural data is available, or computational docking studies to predict binding sites and optimize inhibitor design.

What controls are essential when working with recombinant Streptomyces coelicolor uppP2?

Essential controls for experiments involving recombinant Streptomyces coelicolor uppP2 include:

  • Enzyme quality controls:

    • Purity assessment via SDS-PAGE (≥85% purity is standard)

    • Activity validation using known substrates

    • Stability monitoring throughout storage periods

  • Experimental controls:

    • No-enzyme controls to account for non-enzymatic substrate degradation

    • Heat-inactivated enzyme controls to confirm enzyme-specific activity

    • Known inhibitor controls when testing novel compounds

    • Buffer-only controls to establish baseline measurements

  • Genetic controls when performing in vivo studies:

    • Wild-type S. coelicolor strains

    • uppP2 knockout strains

    • Complemented knockout strains

These controls ensure experimental rigor and enable proper interpretation of results, particularly when investigating enzyme kinetics or inhibitor efficacy.

How can researchers utilize uppP2 to study antibiotic resistance mechanisms in Streptomyces?

Undecaprenyl-diphosphatase 2 has been implicated in bacitracin resistance, as indicated by its alternative name "Bacitracin resistance protein 2" . To study this connection, researchers should implement a comprehensive approach combining biochemical and genetic methodologies:

  • Generate uppP2 knockout and overexpression strains in S. coelicolor

  • Perform minimum inhibitory concentration (MIC) assays with bacitracin and other cell wall-targeting antibiotics

  • Conduct transcriptomic analysis to identify compensatory mechanisms when uppP2 is deleted

  • Assess changes in cell wall composition using analytical techniques like HPLC and mass spectrometry

  • Perform in vitro enzymatic assays with purified uppP2 in the presence of bacitracin

This multi-disciplinary approach can reveal how uppP2 contributes to intrinsic antibiotic resistance and potentially identify novel targets for antibiotic development.

What strategies can be employed to resolve contradictory data regarding uppP2 function?

When confronted with contradictory data regarding uppP2 function, researchers should implement a systematic troubleshooting approach:

  • Methodological validation:

    • Verify enzyme purity and activity using multiple independent methods

    • Ensure experimental conditions are physiologically relevant

    • Confirm antibody specificity when using immunological detection methods

  • Comprehensive analysis:

    • Employ multiple experimental systems (in vitro, cell-based, in vivo)

    • Use both genetic (gene deletion, complementation) and biochemical approaches

    • Perform careful time-course studies to detect temporal aspects of enzyme function

  • Address potential confounding factors:

    • Evaluate potential redundancy with other undecaprenyl-diphosphatases in S. coelicolor

    • Consider environmental conditions that might influence enzyme activity

    • Assess post-translational modifications that could alter function

By implementing this structured approach, researchers can identify sources of inconsistency and develop a more cohesive understanding of uppP2 function.

How does Streptomyces coelicolor uppP2 compare structurally and functionally to homologous enzymes in other bacteria?

Streptomyces coelicolor uppP2 belongs to a family of undecaprenyl-diphosphatases found across bacterial species. Comparative analysis reveals both conservation and divergence:

Bacterial SpeciesEnzyme NameSequence Identity*Notable Functional Differences
Streptomyces coelicoloruppP2100% (reference)UDP pyrophosphate phosphatase activity
Chromobacterium violaceumuppP2~30-40%Similar substrate specificity
Rhizobium lotiuppP2~35-45%Similar enzymatic function
Agrobacterium tumefaciensuppP2~30-40%Potential role in plant interaction
Clostridium difficileuppP2~25-35%Similar undecaprenyl-diphosphatase activity

*Approximate values based on typical bacterial enzyme conservation

These enzymes share a core catalytic mechanism involving metal-dependent hydrolysis of pyrophosphate bonds, but differences in substrate specificity, regulation, and cellular localization may reflect adaptations to specific bacterial lifestyles and cell wall structures.

What methodologies are recommended for conducting phylogenetic analyses of uppP2 across Actinobacteria?

For robust phylogenetic analysis of uppP2 across Actinobacteria, researchers should implement the following methodological approach:

  • Sequence acquisition:

    • Retrieve uppP2 sequences from public databases (NCBI, UniProt)

    • Include representative species across Actinobacteria with emphasis on Streptomycetes

    • Incorporate appropriate outgroups from other bacterial phyla

  • Sequence analysis:

    • Perform multiple sequence alignment using MUSCLE or MAFFT algorithms

    • Refine alignments manually to remove poorly aligned regions

    • Identify conserved catalytic motifs and structural elements

  • Phylogenetic reconstruction:

    • Employ multiple tree-building methods (Maximum Likelihood, Bayesian Inference)

    • Assess node support through bootstrap analysis (>1000 replicates)

    • Test alternative evolutionary models to find best fit

  • Functional correlation:

    • Map known functional properties onto the phylogenetic tree

    • Correlate evolutionary relationships with ecological niches and antibiotic production

    • Identify potential horizontal gene transfer events

This comprehensive approach will provide insights into the evolutionary history of uppP2 and its relationship to bacterial adaptation and specialization within Actinobacteria.

What imaging techniques are most appropriate for visualizing uppP2 localization in Streptomyces coelicolor?

Visualizing uppP2 localization in Streptomyces coelicolor presents unique challenges due to the organism's filamentous growth and complex cell wall architecture . A multi-technique approach is recommended:

  • Fluorescence microscopy:

    • Generate translational fusions of uppP2 with fluorescent proteins (GFP, mCherry)

    • Use inducible promoters to control expression levels

    • Apply super-resolution techniques (STORM, PALM) for detailed subcellular localization

  • Immunolocalization:

    • Develop specific antibodies against uppP2

    • Use electron microscopy with immunogold labeling for high-resolution imaging

    • Perform co-localization studies with other cell wall biosynthesis proteins

  • Live-cell imaging:

    • Track uppP2-fluorescent protein fusions during different growth phases

    • Correlate localization with cell wall growth patterns

    • Perform FRAP (Fluorescence Recovery After Photobleaching) to assess protein dynamics

These techniques should be combined with controls that verify functionality of tagged proteins and account for Streptomyces' characteristic mycelial growth pattern and sporulation stages .

How can researchers effectively measure the impact of uppP2 mutations on cell wall integrity?

To comprehensively assess the impact of uppP2 mutations on cell wall integrity in Streptomyces coelicolor, researchers should implement a multi-parametric approach:

  • Growth phenotype characterization:

    • Monitor colony morphology on solid media

    • Assess growth rates in liquid culture

    • Examine spore formation and germination efficiency

  • Cell wall composition analysis:

    • Quantify peptidoglycan crosslinking using HPLC

    • Analyze lipid II and undecaprenyl phosphate pools using mass spectrometry

    • Measure cell wall thickness via transmission electron microscopy

  • Stress resistance profiling:

    • Test susceptibility to cell wall-targeting antibiotics

    • Evaluate osmotic stress tolerance

    • Assess resistance to detergents and lysozyme

  • Molecular dynamics:

    • Monitor peptidoglycan synthesis rates using fluorescent D-amino acids

    • Track cell wall turnover using pulse-chase experiments

    • Assess changes in gene expression of cell wall synthesis pathway components

This comprehensive approach will provide a detailed understanding of how uppP2 mutations affect cell wall integrity and potentially identify compensatory mechanisms that maintain viability despite enzyme dysfunction.

How does uppP2 activity correlate with antibiotic production in Streptomyces coelicolor?

The relationship between uppP2 activity and antibiotic production in Streptomyces coelicolor represents an intriguing intersection of primary and secondary metabolism. While direct evidence from the search results is limited, a methodological framework for investigating this correlation includes:

  • Expression analysis:

    • Monitor uppP2 expression levels during different growth phases

    • Compare expression patterns with antibiotic biosynthetic gene clusters activation

    • Perform RNA-seq to identify potential regulatory connections

  • Genetic manipulation:

    • Create uppP2 mutants with altered expression levels

    • Quantify antibiotic production in these strains using HPLC and bioassays

    • Perform complementation studies to confirm phenotype specificity

  • Metabolic flux analysis:

    • Track carbon flow between primary metabolism and antibiotic biosynthesis

    • Measure undecaprenyl phosphate pools and their correlation with secondary metabolite production

    • Investigate if cell wall precursor availability influences antibiotic biosynthesis

Given that Streptomyces species are known for antibiotic production , understanding how primary metabolism enzymes like uppP2 influence or respond to secondary metabolism activation could provide insights into optimizing antibiotic yield and discovering novel regulatory mechanisms.

What are the most effective experimental designs for studying uppP2 in the context of Streptomyces development and differentiation?

Studying uppP2 in the context of Streptomyces development requires experimental designs that account for the complex life cycle of these bacteria, which includes vegetative growth, aerial mycelium formation, and sporulation . An effective experimental framework should include:

  • Developmental time-course analysis:

    • Monitor uppP2 expression and activity across all developmental stages

    • Correlate enzyme function with morphological changes using microscopy

    • Perform cell-type specific analyses to distinguish between substrate and aerial hyphae

  • Conditional expression systems:

    • Develop inducible promoters to control uppP2 expression at specific developmental stages

    • Create reporter fusions to track uppP2 activity in real-time

    • Implement CRISPR interference for temporal gene silencing

  • Spatial analysis:

    • Use laser capture microdissection to isolate different cellular compartments

    • Perform in situ hybridization to localize uppP2 mRNA in colonies

    • Develop microfluidic systems to track single-cell dynamics during differentiation

  • Integrated multi-omics:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Focus on transitions between developmental stages

    • Compare wild-type and uppP2 mutant strains at equivalent developmental points

This comprehensive approach will help elucidate how uppP2 function is integrated into the complex developmental program of Streptomyces coelicolor, potentially revealing novel regulatory mechanisms governing the transition between growth and differentiation.

What methodologies are recommended for elucidating the regulatory network controlling uppP2 expression?

To comprehensively map the regulatory network controlling uppP2 expression in Streptomyces coelicolor, researchers should implement the following methodological approaches:

  • Promoter analysis:

    • Identify the uppP2 promoter region through 5' RACE

    • Construct promoter-reporter fusions with varying lengths of upstream sequence

    • Perform site-directed mutagenesis of potential regulatory elements

  • Transcription factor identification:

    • Conduct DNA-protein interaction studies (EMSA, ChIP-seq)

    • Perform one-hybrid screens to identify proteins binding to the uppP2 promoter

    • Use mass spectrometry to identify proteins pulled down with promoter sequences

  • Regulatory network mapping:

    • Analyze transcriptomic data from various growth conditions and mutant strains

    • Implement network inference algorithms to identify potential regulatory connections

    • Validate predicted interactions through targeted experiments

  • Signal response characterization:

    • Test uppP2 expression under various stress conditions (cell wall stress, nutrient limitation)

    • Identify second messengers that might regulate expression (c-di-GMP, ppGpp)

    • Map signal transduction pathways connecting environmental stimuli to uppP2 regulation

This multi-faceted approach will provide a comprehensive understanding of how uppP2 expression is controlled within the complex regulatory networks of Streptomyces coelicolor, potentially revealing novel mechanisms of cell wall homeostasis regulation.

How can researchers investigate potential feedback mechanisms between uppP2 activity and cell wall precursor biosynthesis?

Investigating feedback mechanisms between uppP2 activity and cell wall precursor biosynthesis requires a systems biology approach that integrates multiple levels of analysis:

  • Metabolite profiling:

    • Quantify undecaprenyl phosphate, undecaprenyl pyrophosphate, and peptidoglycan precursors using LC-MS/MS

    • Monitor changes in these metabolites in response to uppP2 modulation

    • Perform pulse-chase experiments to track metabolic flux

  • Enzyme activity regulation:

    • Assess whether uppP2 activity is directly regulated by substrate or product concentrations

    • Investigate post-translational modifications that might modulate enzyme function

    • Determine if protein-protein interactions affect uppP2 activity

  • Transcriptional response analysis:

    • Perform RNA-seq to identify genes co-regulated with uppP2

    • Monitor expression of cell wall biosynthesis genes in uppP2 mutants

    • Use reporter constructs to track real-time changes in gene expression

  • Mathematical modeling:

    • Develop kinetic models of the cell wall biosynthesis pathway

    • Incorporate experimentally determined parameters

    • Simulate the effects of perturbations to identify potential feedback loops

This comprehensive approach will help elucidate how S. coelicolor maintains cell wall homeostasis through regulatory connections between uppP2 and other components of the cell wall biosynthesis machinery.

What emerging technologies could advance our understanding of uppP2 structure-function relationships?

Several cutting-edge technologies hold promise for deepening our understanding of uppP2 structure-function relationships:

  • Cryo-electron microscopy (cryo-EM):

    • Enable visualization of uppP2 in its native membrane environment

    • Reveal conformational changes during catalysis

    • Provide insights into protein-substrate interactions at near-atomic resolution

  • Advanced computational methods:

    • Apply molecular dynamics simulations to model enzyme dynamics

    • Use quantum mechanics/molecular mechanics (QM/MM) to study reaction mechanisms

    • Implement machine learning for predicting functional effects of mutations

  • Single-molecule techniques:

    • Utilize single-molecule FRET to monitor conformational changes

    • Apply optical tweezers to study enzyme-substrate interactions

    • Perform single-molecule tracking in live cells to assess dynamics

  • In-cell structural biology:

    • Implement in-cell NMR to study uppP2 structure in native environments

    • Apply protein correlative light-electron microscopy for precise cellular localization

    • Use chemical cross-linking mass spectrometry to identify interaction partners

These technologies, when integrated, will provide unprecedented insights into how uppP2 structure relates to its function in cell wall biosynthesis and potentially reveal novel targets for antibiotic development.

How might systems biology approaches enhance our understanding of uppP2's role in Streptomyces coelicolor?

Systems biology approaches offer powerful frameworks for contextualizing uppP2 function within the broader cellular network of Streptomyces coelicolor:

  • Multi-omics integration:

    • Combine genomics, transcriptomics, proteomics, and metabolomics data

    • Develop comprehensive models of cell wall biosynthesis pathways

    • Identify emergent properties not apparent from individual analyses

  • Genome-scale metabolic modeling:

    • Incorporate uppP2 into genome-scale metabolic reconstructions

    • Perform flux balance analysis to predict effects of uppP2 perturbation

    • Identify potential metabolic vulnerabilities related to cell wall biosynthesis

  • Network analysis:

    • Map protein-protein interaction networks centered on uppP2

    • Identify functional modules and redundant pathways

    • Discover potential synthetic lethal interactions for antibiotic development

  • Comparative systems biology:

    • Compare uppP2-centered networks across different Streptomyces species

    • Identify conserved and species-specific features

    • Correlate network differences with phenotypic variations

By implementing these systems biology approaches, researchers can develop a holistic understanding of how uppP2 functions within the complex cellular machinery of Streptomyces coelicolor, potentially leading to novel insights into bacterial physiology and antibiotic discovery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.