Recombinant Streptomyces coelicolor UPF0060 membrane protein SCO3297 (SCO3297)

Shipped with Ice Packs
In Stock

Description

Primary Structure

The primary structure of a protein refers to the unique sequence of amino acids in a polypeptide chain . These amino acids are linked by peptide bonds, which form during protein biosynthesis . The primary structure is determined by the gene that corresponds to the protein . A change in the nucleotide sequence of the gene can lead to a different amino acid being added to the polypeptide chain, thus altering the protein's structure and function .

Secondary Structure

The secondary structure describes the local folding patterns within a polypeptide chain . The most common types are α-helices and β-pleated sheets . These structures are stabilized by hydrogen bonds between the amino and carboxyl groups of non-adjacent amino acids . Alpha-helices are spiral shapes, while beta-pleated sheets are formed by hydrogen bonding between atoms on the polypeptide chain's backbone .

Protein Folding

Protein folding is the process by which a protein molecule attains its functional shape or conformation . Proteins, being heterogeneous unbranched chains of amino acids, must fold correctly to perform their biological functions . The interactions between amino acid side chains guide this folding process .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for tailored fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SCO3297; SCE15.14; UPF0060 membrane protein SCO3297
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Target Names
SCO3297
Target Protein Sequence
MLVLRSAALFVVAALFEIGGAWLVWQGVREQRGWLWAAGGVLALGAYGFVATFQPDAHFG RILAAYGGIFVTGSILWGVVADGYRPDRWDIAGALVCLAGMALIMWAPRNGG
Uniprot No.

Target Background

Database Links

KEGG: sco:SCO3297

STRING: 100226.SCO3297

Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the SCO3297 gene in Streptomyces coelicolor?

The SCO3297 gene encodes a membrane protein of the UPF0060 family and is positioned within the S. coelicolor A3(2) chromosome. When considering genomic context, it's important to examine neighboring genes that may form part of an operon or functional unit. Unlike the extensively studied small RNA scr3559 (located near SCO3559) that affects development and antibiotic production , the genomic neighborhood of SCO3297 has not been extensively characterized in the available literature.

  • Promoter prediction analysis to identify transcriptional units

  • RNAseq data mining to determine co-transcribed genes

  • Comparative genomics across multiple Streptomyces species to identify conserved gene clusters

What expression systems are recommended for producing recombinant SCO3297?

For successful expression of membrane proteins like SCO3297, multiple expression systems should be evaluated:

Expression SystemAdvantagesDisadvantagesSpecial Considerations
E. coli BL21(DE3)High yield, simple protocolsPotential improper foldingConsider fusion with MBP or SUMO tags
E. coli C41/C43Specialized for membrane proteinsLower yieldsUse auto-induction media
Streptomyces lividansNative-like post-translational modificationsSlower growthHomologous recombination using pIJ702
Cell-free systemsAvoids toxicity issuesExpensiveSupplement with membrane mimetics

When expressing SCO3297, parallel constructs with various tags (His6, Strep-tag II, FLAG) should be generated to determine optimal expression and purification conditions. Based on approaches used for similar proteins in S. coelicolor, induction at lower temperatures (16-20°C) often improves proper folding of membrane proteins .

What purification strategies yield functional SCO3297 protein?

Purification of membrane proteins requires specialized approaches:

  • Membrane fraction isolation using differential centrifugation (30,000-100,000×g)

  • Detergent screening panel including:

    • Mild detergents: DDM, LMNG, Digitonin

    • Zwitterionic detergents: CHAPS, LDAO

    • Newer amphipols and SMALPs for native-like environment retention

The purification protocol should be validated using multiple criteria including:

  • SDS-PAGE analysis for purity

  • Western blotting for identity confirmation

  • Size-exclusion chromatography for aggregation assessment

  • Circular dichroism to verify secondary structure

Similar to methods used for other S. coelicolor membrane proteins, a two-step purification involving IMAC followed by size exclusion chromatography typically yields protein of sufficient purity for further analyses .

How can functional characterization of SCO3297 be approached?

As a membrane protein of unknown function, multiple parallel approaches should be implemented:

  • Genetic approaches:

    • Construction of SCO3297 deletion mutants in S. coelicolor using CRISPR-Cas9 or traditional homologous recombination

    • Complementation studies with wild-type and mutant variants

    • Phenotypic analysis across different growth conditions

  • Biochemical approaches:

    • Lipid binding assays using fluorescence anisotropy

    • Ion transport assays if channel/transporter function is suspected

    • Interaction studies with other membrane components

  • Structural biology:

    • Cryo-EM for native structure determination

    • X-ray crystallography following LCP (Lipidic Cubic Phase) crystallization

    • NMR studies for dynamic analyses

When designing these experiments, consider the developmental timeline of S. coelicolor, as many membrane proteins show stage-specific expression patterns related to morphological differentiation and secondary metabolism activation .

What role might SCO3297 play in antibiotic production and morphological development?

Given that many membrane proteins in S. coelicolor participate in signaling pathways affecting both development and secondary metabolism, investigations should examine:

  • Expression profiling of SCO3297 across developmental stages (vegetative mycelium, aerial hyphae, sporulation)

  • Analysis of secondary metabolite production in SCO3297 mutants:

    • Actinorhodin

    • Undecylprodigiosin

    • Coelimycin P1

    • Germicidins

    • Desferrioxamines

  • Transcriptomic analysis of SCO3297 overexpression and deletion strains, focusing on:

    • Developmental regulators (bldN, whiG, whiH)

    • Secondary metabolism pathway genes

    • Stress response genes

Similar to analyses performed for the scr3559 RNA, which revealed impacts on antibiotic production timing and levels, SCO3297 might regulate membrane-associated processes critical for development .

How might SCO3297 interact with regulatory systems controlling Streptomyces development?

Membrane proteins can function as sensors or signal transducers in developmental pathways. Investigation methods include:

  • Bacterial two-hybrid screens to identify protein interaction partners

  • Phosphoproteomics to determine if SCO3297 participates in phosphorelay systems

  • Localization studies using fluorescent protein fusions to track subcellular distribution during development

  • Comparative expression analysis with known developmental regulators like:

    • BldN (aerial mycelium formation)

    • WhiG (early sporulation regulator)

    • ScbA/ScbR (γ-butyrolactone signaling system)

These approaches have successfully identified regulatory networks for other S. coelicolor proteins involved in developmental control .

What analytical techniques are most informative for studying SCO3297 membrane integration?

Membrane protein topology and integration can be studied using:

  • Protease accessibility assays:

    • Limited proteolysis with LC-MS/MS analysis

    • PEGylation of accessible cysteine residues

  • Fluorescence-based approaches:

    • FRET analysis with domain-specific tags

    • pH-sensitive GFP variants for orientation determination

  • Computational prediction validation:

    • TMHMM and TOPCONS prediction verification

    • Evolutionary coupling analysis

These approaches are complementary and provide structural insights without requiring high-resolution structural determination, which can be challenging for membrane proteins .

How can contradictory results in SCO3297 functional studies be reconciled?

When facing contradictory data, a systematic troubleshooting approach includes:

  • Expression condition validation:

    • Verify protein folding using circular dichroism

    • Confirm membrane integration using fractionation studies

    • Test multiple detergent and lipid environments

  • Experimental design considerations:

    • Include appropriate positive and negative controls

    • Analyze time-dependent effects (considering S. coelicolor's complex life cycle)

    • Test under various physiological stresses

  • Multi-technique validation:

    • Confirm key findings using orthogonal methods

    • Consider strain-specific effects if using different S. coelicolor derivatives

    • Validate in vivo findings with in vitro reconstitution

As observed with studies on scr3559 RNA, seemingly contradictory phenotypes may reflect complex regulatory networks with condition-dependent outcomes .

How should transcriptomic data for SCO3297 mutants be analyzed?

Transcriptomic analysis requires specialized approaches for membrane protein studies:

  • Experimental design:

    • Time course sampling covering key developmental transitions

    • Multiple growth conditions (minimal vs. rich media)

    • Comparison with regulatory mutants affecting similar processes

  • Analytical framework:

    • Differential expression analysis using DESeq2 or EdgeR

    • Gene Set Enrichment Analysis focusing on:

      • Membrane transport processes

      • Secondary metabolism clusters

      • Developmental regulons

    • Co-expression network analysis to identify functionally related genes

  • Visualization approaches:

    • Clustered heatmaps of expression changes

    • Volcano plots highlighting statistically significant changes

    • Pathway mapping using KEGG or BioCyc databases

Similar approaches revealed that the C6S strain (overexpressing scr3559) showed altered expression of developmental regulators like bldN, whiG, and whiH, providing insights into the RNA's regulatory functions .

What bioinformatic approaches can predict SCO3297 function?

Multiple computational approaches provide functional insights:

  • Sequence-based analysis:

    • Hidden Markov Model searches across bacterial proteomes

    • Conservation analysis focused on UPF0060 family members

    • Identification of functional motifs and domains

  • Structural prediction:

    • AlphaFold2 modeling with membrane-specific parameters

    • Molecular dynamics simulations in lipid bilayers

    • Ligand binding site prediction using CASTp and COACH

  • Systems biology integration:

    • Protein-protein interaction network prediction

    • Integration with metabolic models of S. coelicolor

    • Correlation with phenotypic and transcriptomic datasets

These computational approaches complement experimental work and can guide hypothesis generation for targeted functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.