Recombinant Streptomyces griseus subsp. griseus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

General Information

  • Organism: Streptomyces griseus subsp. griseus

  • Subunit: b (atpF)

  • Enzyme: ATP synthase (F-ATPase)

  • Function: Part of the ATP synthase complex involved in ATP production

  • Gene Name: atpF

  • Ordered Locus Names: SGR_2167

  • UniProt Accession Number: B1W0A7

  • Sequence Length: 1-189 amino acids

Structure and Function of ATP Synthase

ATP synthase is a complex molecular machine found in the membranes of bacteria, mitochondria, and chloroplasts . It uses the energy from a proton gradient to synthesize ATP from adenosine diphosphate (ADP) and inorganic phosphate . The enzyme consists of two main parts:

  • F1 Sector: The catalytic core where ATP is synthesized. It is a soluble complex composed of five different subunits: α, β, γ, δ, and ε. The β subunits adopt 'open', 'closed', and 'open' conformations, showing species-specific differences .

  • F0 Sector: The membrane-embedded portion that allows proton translocation across the membrane, driving the rotation of the c-ring. Subunit b interacts with subunit a, and mutations in this region can be detrimental to the assembly and activity of the complex .

Streptomyces griseus and ATP Synthase

Streptomyces griseus is a Gram-positive bacterium known for producing various secondary metabolites, including streptomycin and valinomycin . The ATP synthase in Streptomyces griseus, like in other bacteria, is crucial for energy production and maintaining cellular functions . The subunit b (atpF) plays a critical role in the structural integrity and function of the F0 sector .

Role of A-factor in Streptomyces griseus

In Streptomyces griseus, the production of streptomycin is regulated by A-factor, a butyrolactone signaling molecule . A-factor binds to its receptor protein ArpA, which then affects the transcription of various genes, including those involved in streptomycin biosynthesis . While the atpF gene is not directly regulated by A-factor, ATP is essential for the biosynthesis of streptomycin and other secondary metabolites .

Applications and Research

Recombinant ATP synthase subunit b (atpF) from Streptomyces griseus is used in research for several purposes:

  • ELISA Assays: It can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) to detect and quantify anti-atpF antibodies .

  • Structural Studies: To investigate the structure and function of ATP synthase and its subunits .

  • Drug Discovery: ATP synthase is a target for developing new antibacterial drugs .

Relevant Data

PropertyDescription
OrganismStreptomyces griseus subsp. griseus
Protein NameATP synthase subunit b
Gene NameatpF
UniProt Accession No.B1W0A7
Sequence Length189 amino acids
FunctionComponent of the ATP synthase complex, essential for ATP production
ApplicationsELISA assays, structural studies, drug discovery
Storage ConditionsStore at -20°C; avoid repeated freezing and thawing
Storage BufferTris-based buffer, 50% glycerol

Cautionary Notes

  • Repeated freezing and thawing of the recombinant protein are not recommended, as this can lead to degradation and loss of activity .

  • When using the recombinant protein in experiments, ensure that proper controls are included to account for any potential non-specific effects .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
atpF; SGR_2167; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350)
Target Names
atpF
Target Protein Sequence
MAVAPFDERSTMMYLAAEEPQMPLLPVWPEVVIGLICFGIVFFVFSKKLLPVINKTLEER REAIEGGIEKAESAQIEAQSVLEQYKAQLAEARHEAARLRQEAQEQGAVIIQEMKAEGQR QREEIIAAGHTQIEADRKAAASALRQDVGKLATDLAGKLVGESLQDHARQSGTVDRFLDE LEAKAEAAR
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core; and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This subunit is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b (atpF) in Streptomyces griseus? (Basic)

ATP synthase subunit b (atpF) in S. griseus is a critical component of the F0 sector of the F1F0 ATP synthase complex. This transmembrane protein forms part of the peripheral stalk (or stator) that connects the membrane-embedded F0 sector to the matrix-exposed F1 sector. The peripheral stalk prevents rotation of the α3β3 hexamer during catalysis, allowing the central rotor to rotate within it and enabling ATP synthesis.

The protein has a molecular weight of approximately 20,895 Da and consists of 189 amino acids . The peripheral stalk that includes subunit b is important for both the stability and assembly of the ATP synthase complex. Studies have shown that the peripheral stalk is essential for the stability of the c-ring/F1 complex .

How does the structure of S. griseus ATP synthase subunit b differ from other bacterial species? (Advanced)

While the primary sequence of ATP synthase subunit b varies among bacterial species, its structural features and functional domains are generally conserved. The S. griseus atpF exhibits the characteristic transmembrane domain at its N-terminus (as evidenced by the sequence "VVIGLICFGIVFFVFS") and a hydrophilic C-terminal domain that interacts with the F1 sector .

Comparative sequence analysis reveals that the ATP synthase subunit b from S. griseus shares structural similarities with other actinomycetes but has distinctive features that reflect its adaptation to the high GC content genome and the filamentous lifestyle of Streptomyces . Unlike E. coli, which has two b subunits (b and b'), S. griseus, like most bacteria, has a single type of b subunit that forms a homodimer in the stator.

The conservation of atpF and other ATP synthase genes makes them useful markers for phylogenetic analysis, as demonstrated by their use in multilocus sequence analysis (MLSA) studies of Streptomyces species .

What post-translational modifications are known to occur in S. griseus ATP synthase components? (Advanced)

Although specific post-translational modifications of atpF in S. griseus have not been extensively documented, research on ATP synthase components in other organisms provides insights. In mammalian systems, phosphorylation of the β subunit of ATP synthase has been shown to affect both enzyme activity and complex assembly .

A study on phosphorylation of ATP synthase β subunit in yeast identified several phosphorylation sites that had distinct effects on ATP synthase function. For instance, phosphorylation at T262 abolished activity, while the nonphosphorylatable strain (T262A) maintained normal ATPase rates . Additionally, phosphorylation at T58 altered the formation and maintenance of ATP synthase dimers .

Similar regulatory mechanisms might exist in S. griseus, especially considering that S. griseus possesses sophisticated regulatory networks for controlling both primary and secondary metabolism. Research has shown that S. griseus can phosphorylate streptomycin using ATP in old mycelium at stationary to autolyzing stages, demonstrating the presence of ATP-dependent phosphorylation mechanisms .

What expression systems are optimal for producing recombinant S. griseus ATP synthase subunit b? (Basic)

Several expression systems have been successfully used to produce recombinant S. griseus ATP synthase subunit b:

  • Cell-free expression systems: These have proven effective for expressing transmembrane proteins like atpF. The absence of cellular membranes allows for the direct synthesis of membrane proteins without toxicity issues .

  • Yeast expression systems: Commercial recombinant atpF is often produced in yeast systems, which provide eukaryotic post-translational modifications while maintaining high yields .

  • E. coli expression systems: Though not ideal for all membrane proteins, optimized E. coli strains with appropriate fusion tags can be used for atpF expression.

When expressing atpF, it's crucial to consider its transmembrane nature. Successful expression might require:

  • Fusion tags that enhance solubility or facilitate purification

  • Specialized detergents for extraction and purification

  • Controlled induction conditions to prevent toxicity

The choice of expression system should be guided by the specific experimental requirements, including the need for post-translational modifications, protein folding, and intended downstream applications.

What are the challenges in purifying membrane-associated proteins like ATP synthase subunit b? (Advanced)

Purification of membrane proteins like ATP synthase subunit b presents several challenges:

  • Detergent selection: The choice of detergent is critical for extracting the protein from membranes while maintaining its native structure. A systematic approach testing multiple detergents (e.g., DDM, CHAPS, Triton X-100) at various concentrations is recommended.

  • Protein stability: Membrane proteins often exhibit reduced stability when removed from their lipid environment. Inclusion of lipids or lipid-like molecules during purification can enhance stability.

  • Aggregation issues: atpF tends to aggregate when overexpressed or during purification. Methods to address this include:

    • Using fusion partners that enhance solubility

    • Optimizing buffer compositions (pH, ionic strength, additives)

    • Including glycerol (typically 50%) in storage buffers

  • Maintaining functionality: Ensuring that the purified protein retains its native structure and function requires careful optimization of purification conditions and often requires functional assays.

  • Scale-up limitations: The yield of membrane proteins is typically lower than that of soluble proteins, making scale-up more challenging.

A purification strategy for S. griseus atpF might involve:

  • Affinity chromatography using an appropriate fusion tag

  • Size exclusion chromatography to separate aggregates

  • Ion exchange chromatography for final polishing

Commercial preparations typically achieve >85% purity as determined by SDS-PAGE , which is sufficient for many research applications.

What techniques can effectively analyze the structure-function relationship of S. griseus ATP synthase subunit b? (Basic)

Several complementary techniques can be used to analyze the structure-function relationship of S. griseus ATP synthase subunit b:

  • Site-directed mutagenesis: Systematic mutation of key residues can reveal their importance in protein function. For example, mutations in transmembrane regions can assess their role in membrane anchoring, while mutations in the C-terminal domain can evaluate interactions with other subunits.

  • Protein-protein interaction assays: Techniques such as pull-down assays, co-immunoprecipitation, or yeast two-hybrid screens can identify interaction partners of atpF within the ATP synthase complex.

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Fluorescence spectroscopy to monitor conformational changes

    • Isothermal titration calorimetry (ITC) to measure binding affinities

  • Structural analysis:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (increasingly useful for membrane protein complexes)

    • NMR spectroscopy for specific domains

  • Functional assays:

    • ATP synthesis/hydrolysis assays using reconstituted systems

    • Membrane potential measurements in proteoliposomes

These techniques can provide insights into how atpF contributes to the assembly, stability, and function of the ATP synthase complex in S. griseus.

How can CRISPR-Cas9 be optimized for genetic manipulation of ATP synthase genes in Streptomyces? (Advanced)

CRISPR-Cas9 technology has revolutionized genome editing in Streptomyces, but several optimizations are necessary for effective manipulation of ATP synthase genes:

  • Modified Cas9 for high GC content genomes: Standard CRISPR-Cas9 systems may exhibit off-target effects in the high GC content Streptomyces genome. Recent innovations include Cas9-BD, a modified Cas9 with polyaspartate additions to its N- and C-termini, which demonstrates decreased off-target binding and reduced cytotoxicity .

  • sgRNA design considerations:

    • Target selection should account for the high GC content in ATP synthase genes

    • Design multiple sgRNAs targeting different regions of the gene

    • Validate sgRNA efficiency using in silico tools optimized for Streptomyces

    • Consider the use of multiplexed sgRNA libraries for complex manipulations

  • Delivery methods:

    • Conjugation from E. coli is typically most effective

    • Optimize protoplast transformation protocols for specific Streptomyces strains

    • Consider temperature-sensitive plasmids for transient expression

  • Screening strategies:

    • Design PCR primers that can distinguish wild-type from edited sequences

    • Consider phenotypic screens that can detect changes in ATP synthesis

    • Use next-generation sequencing to verify edits and check for off-target effects

Research has demonstrated successful application of modified CRISPR-Cas9 systems to many Streptomyces species, providing versatile and efficient genome editing tools . For ATP synthase genes, which are essential, conditional knockouts or precise point mutations may be more appropriate than complete gene deletions.

How does ATP synthase activity relate to secondary metabolism in S. griseus? (Basic)

ATP synthase activity and secondary metabolism in S. griseus are interconnected through several mechanisms:

  • Energy supply: Secondary metabolite production is energetically expensive. ATP synthase provides the ATP required for the activation of precursors, transport processes, and other energy-demanding steps in antibiotic biosynthesis, including streptomycin production.

  • Developmental regulation: In S. griseus, secondary metabolism is typically initiated during the transition from primary to secondary metabolism, often coinciding with morphological differentiation. ATP levels and energy charge may serve as metabolic cues in this transition.

  • pH and membrane potential effects: ATP synthase activity influences intracellular pH and membrane potential, which can affect the expression and activity of secondary metabolite biosynthetic enzymes.

  • Regulatory crosstalk: Regulators of secondary metabolism, such as the A-factor regulatory cascade in S. griseus, may indirectly influence energy metabolism genes, including ATP synthase components .

The relationship between ATP synthase and secondary metabolism is bidirectional - changes in metabolic state affect antibiotic production, while the production of certain antibiotics can impact energy metabolism .

How do transcriptional regulators influence ATP synthase gene expression in S. griseus? (Advanced)

ATP synthase gene expression in S. griseus is subject to complex regulatory control involving several transcriptional regulators:

Recent research has revealed that AfsR binds to promoter regions and interacts with RNA polymerase through extensive protein-protein interactions with conserved domains (β flap, σHrdBR4, and αCTD) . Similar mechanisms might apply to the regulation of ATP synthase genes, particularly in response to changing energy demands during development and secondary metabolism.

The table below summarizes key transcriptional regulators potentially affecting ATP synthase gene expression:

RegulatorTypeFunctionPotential impact on ATP synthase
HrdB (σHrdB)Principal sigma factorTranscription of housekeeping genesDirect transcriptional activation
ShbA (σShbA)Alternative sigma factorGoverns σHrdB expressionIndirect regulation via σHrdB
AfsRSARP family regulatorGlobal regulator with ATPase activityMetabolic coordination
BldDPleiotropic negative regulatorControls morphological developmentDevelopmental regulation
AdpACentral regulatorA-factor regulatory cascadeCoordination with secondary metabolism

How can S. griseus ATP synthase components be engineered for enhanced bioenergetics? (Advanced)

Engineering S. griseus ATP synthase components for enhanced bioenergetics involves several strategic approaches:

  • Structure-guided mutations: Based on the knowledge of critical residues in ATP synthase subunits, targeted mutations can be introduced to:

    • Enhance catalytic efficiency (e.g., by optimizing the binding pocket for ATP/ADP)

    • Improve proton conductance through the F0 sector

    • Strengthen subunit interactions for better complex stability

  • Heterologous expression optimization: Expression of engineered ATP synthase components can be optimized by:

    • Using strong, inducible promoters (e.g., ermE* promoter)

    • Optimizing codon usage for improved translation efficiency

    • Co-expressing chaperones to assist in proper folding and assembly

  • Metabolic engineering strategies:

    • Overexpression of ATP synthase components like atpF might enhance ATP production capacity

    • Integration with other metabolic engineering efforts, such as enhancing precursor supply

    • Combining ATP synthase modifications with alterations in electron transport chain components

  • Regulatory engineering: Modifying the regulation of ATP synthase genes through:

    • Altering transcriptional regulation (e.g., using constitutive promoters)

    • Engineering ribosome binding sites for improved translation

    • Removing regulatory constraints (e.g., feedback inhibition)

  • Cross-species hybrid systems: Creating chimeric ATP synthases by combining components from different species that exhibit desired properties (e.g., thermostability, pH tolerance).

A practical approach for engineering ATP synthase in S. griseus would be to first establish methods for functional assessment of ATP synthesis in vivo, then create a library of variants, and finally screen for enhanced activity under relevant conditions.

What methods can be used to study the role of ATP synthase in streptomycin production by S. griseus? (Basic)

Several methodological approaches can be used to investigate the relationship between ATP synthase function and streptomycin production:

  • Genetic manipulation:

    • Generate conditional mutants of ATP synthase genes using inducible promoters

    • Create point mutations that alter ATP synthase activity without completely abolishing function

    • Use CRISPR-Cas9 to introduce specific mutations in ATP synthase genes

  • Metabolic measurements:

    • Monitor intracellular ATP levels during streptomycin production using luciferase-based assays

    • Measure membrane potential using fluorescent dyes (e.g., DiBAC4)

    • Quantify proton gradient formation using pH-sensitive fluorescent proteins

  • Proteomics approaches:

    • Analyze changes in ATP synthase subunit expression and post-translational modifications during streptomycin production

    • Use protein-protein interaction studies to identify connections between ATP synthase components and streptomycin biosynthetic enzymes

    • Apply quantitative proteomics to compare protein levels during different production phases

  • Inhibitor studies:

    • Use specific ATP synthase inhibitors (e.g., oligomycin) at sub-lethal concentrations to modulate activity

    • Monitor the effects on streptomycin production and precursor accumulation

    • Combine with metabolomic analyses to track metabolic fluxes

  • Biophysical techniques:

    • Measure ATP synthase activity in membrane vesicles isolated from S. griseus at different stages of streptomycin production

    • Use isotope labeling to track ATP turnover and utilization in streptomycin biosynthesis

Combining these approaches can provide a comprehensive understanding of how energy metabolism, specifically ATP synthase activity, supports and regulates streptomycin production in S. griseus.

How conserved is ATP synthase subunit b across different Streptomyces species? (Basic)

ATP synthase subunit b (atpF) shows significant conservation across Streptomyces species, reflecting its essential role in energy metabolism. Analysis of atpF sequences reveals:

  • Sequence conservation: The primary amino acid sequence typically shows >80% identity among closely related Streptomyces species. The transmembrane domain and the C-terminal region that interacts with the F1 sector tend to be most highly conserved.

  • Functional domains: Key functional domains are highly conserved, including:

    • The N-terminal transmembrane helix

    • The dimerization interface

    • The F1-interacting domain

  • Gene neighborhood: The genomic context of atpF is generally conserved within the Streptomyces genus, typically organized in an operon with other ATP synthase components.

The high conservation of ATP synthase genes has made them useful markers for phylogenetic analysis. The atpD gene, encoding the β subunit of ATP synthase F1, is one of five housekeeping genes commonly used in multilocus sequence analysis (MLSA) of Streptomyces species .

What can evolutionary analysis of ATP synthase genes tell us about Streptomyces phylogeny? (Advanced)

Evolutionary analysis of ATP synthase genes provides valuable insights into Streptomyces phylogeny and evolution:

  • Multilocus sequence analysis (MLSA): The atpD gene, encoding ATP synthase F1 β subunit, is one of five housekeeping genes (along with gyrB, recA, rpoB, and trpB) used in MLSA schemes for Streptomyces classification . This approach has been successfully applied to systematic analyses of Streptomyces clades at both inter- and intraspecies levels.

  • Population structure insights: MLSA using ATP synthase genes has revealed:

    • Evidence of homologous recombination within Streptomyces species

    • Habitat-associated genetic differentiation

    • Barriers to recombination between strains from different ecological niches

  • Evolutionary rate variations: ATP synthase genes typically evolve relatively slowly due to functional constraints, making them suitable for resolving relationships among closely related species.

  • Horizontal gene transfer (HGT) assessment: The analysis of incongruencies between ATP synthase gene phylogenies and those of other markers can reveal instances of HGT, which is common in Streptomyces.

  • Adaptation signatures: Selection analysis of ATP synthase genes can identify sites under positive selection, potentially indicating adaptation to specific environmental conditions.

The combined evidence from ATP synthase genes and other housekeeping genes supports a model of Streptomyces evolution where homologous recombination is common but partially limited by ecological barriers, resulting in habitat-associated genetic differentiation . This understanding helps explain the origin and persistence of Streptomyces species diversity and their remarkable adaptability to different environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.