Recombinant Streptomyces griseus subsp. griseus NADH-quinone oxidoreductase subunit K 2 (nuoK2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK2; SGR_2919; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350)
Target Names
nuoK2
Target Protein Sequence
MHLAYPAVLAALLFCVGLYGVLARRNAILVLMSVELMLNAVNLNLVAFDVWLRDTLHSGQ
ALTLFTIAIAAAEIGIGLAIVLAVYRNRGTSAIDRLRDTAETDAAETLPDDAGTGPSGTD
AAPNGDTTTATGRPGDNAGKNKKAEATR
Uniprot No.
Target Background
Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, the primary electron acceptor is believed to be menaquinone. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy within a proton gradient.
Database Links
KEGG: sgr:SGR_2919
STRING: 455632.SGR_2919
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
