Recombinant Streptomyces griseus subsp. griseus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Recombinant UppP Production in Model Systems

While no studies on S. griseus UppP were identified, recombinant UppP from Azospirillum brasilense (UniProt ID: P39438) has been expressed in E. coli with a His-tag . Key parameters from this homolog include:

ParameterDetails
Expression HostE. coli
TagN-terminal His tag
Protein Length187 amino acids (full-length)
Purity>90% (SDS-PAGE verified)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) .

This template could guide analogous recombinant production of S. griseus UppP.

Functional Insights from UppP Homologs

  • Essentiality: In B. subtilis, UppP and BcrC form a synthetic lethal pair; depletion causes cell lysis due to UP shortage .

  • Antibiotic Resistance: UppP overexpression confers bacitracin resistance in E. coli by competing for UPP binding .

  • Sporulation Role: B. subtilis UppP is critical for sporulation, with mutants showing defective spore maturation .

Research Gaps and Future Directions

Despite extensive studies on UppP in E. coli and B. subtilis, no peer-reviewed data exists for S. griseus subsp. griseus recombinant UppP. Key unresolved questions:

  1. Does S. griseus UppP share the periplasmic orientation observed in E. coli ?

  2. How does its activity compare to homologs under antibiotic stress (e.g., bacitracin)?

  3. Can structural modeling (e.g., Rosetta membrane ab initio ) predict its catalytic mechanism?

Industrial and Therapeutic Implications

Streptomyces griseus is a prolific antibiotic producer , and UppP inhibitors (e.g., bacitracin analogs) could synergize with existing cell wall-targeting drugs . Recombinant UppP studies could facilitate:

  • High-throughput screening for novel phosphatase inhibitors.

  • Engineering bacitracin-resistant strains for industrial applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
uppP; SGR_6235; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350)
Target Names
uppP
Target Protein Sequence
MSWFESFVLGLVQGLTEFLPISSSAHLRLTAAFAGWHDPGAAFTAISQIGTEAAVLIYFR KDIARILSAWFRSLTDRSMRGDHDAQMGWLVIVGSIPIGVLGITLKDQIEGPFRDLRLIA TTLIVMGIVLGVADRLAARDETGGKHRVVKERKTLKDLGVKDGLIYGFCQAMALIPGVSR SGATISGGLLMGYTRESAARYSFLLAIPAVLASGAYELKDVGEGHVSWGPTIFATLVAFF VGYAVIAWFMKFITTKSFMPFVIYRILLGVVLFILIWAGVLSPHAGESAG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.