Recombinant Strongylocentrotus franciscanus NADH-ubiquinone oxidoreductase chain 5 (ND5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ND5; NADH-ubiquinone oxidoreductase chain 5; NADH dehydrogenase subunit 5; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Mesocentrotus franciscanus (Giant red sea urchin) (Strongylocentrotus franciscanus)
Target Names
ND5
Target Protein Sequence
MVINPSLIISTLNLGILAILLGSIFFFSKSYFSNENPSLPINKAASAHLSINNKSEAIEY NSGPFAMAILKALALLSVISLLVAINTEFSDINITLSLWLNNTPTNISLNFIYDQYFLIF LSIALIVTWS
Uniprot No.

Target Background

Function

This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 5 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 5 (ND5) and what is its role in Strongylocentrotus franciscanus?

NADH-ubiquinone oxidoreductase chain 5 (ND5) is a mitochondrial protein that functions as a component of the electron transport chain in cellular respiration. In Strongylocentrotus franciscanus (giant red sea urchin), this protein is encoded by the mitochondrial genome and plays a crucial role in energy production. The protein is officially classified as EC 1.6.5.3 and is also known as NADH dehydrogenase subunit 5 . Like other components of the electron transport chain, ND5 is involved in creating the proton gradient necessary for ATP synthesis and is therefore essential for cellular metabolism.

How does ND5 from S. franciscanus compare to other sea urchin species?

Comparative genomic analysis between Strongylocentrotus franciscanus (red sea urchin) and other sea urchin species like Lytechinus variegatus (green sea urchin) has revealed interesting distinctions. These species exhibit extreme diversity in lifespan, with S. franciscanus estimated to live over a century while L. variegatus typically survives no more than four years .

Researchers have sequenced and compared the genomes of these animals, identifying amino acid substitutions in mitochondrial proteins, including ND5, that correlate with longevity differences . Multiple alignments of protein sequences from these sea urchins, along with reference long- and short-lived organisms, have been performed to identify positions containing amino acid variations that discriminate between long- and short-lived organisms . This comparative analysis provides valuable insights into the potential role of mitochondrial proteins in determining species lifespan.

What methods are most effective for recombinant expression of S. franciscanus ND5?

For recombinant expression of Strongylocentrotus franciscanus NADH-ubiquinone oxidoreductase chain 5, researchers typically employ bacterial expression systems optimized for mitochondrial proteins. The recommended methodology involves:

  • Gene synthesis or PCR amplification of the ND5 gene from S. franciscanus mitochondrial DNA

  • Cloning into an expression vector with an appropriate tag (determination of tag type should be adapted to the specific experimental needs)

  • Expression in E. coli strains optimized for membrane proteins

  • Purification using affinity chromatography based on the selected tag

  • Buffer optimization containing Tris-based buffer with 50% glycerol

It's important to note that as a mitochondrial membrane protein, ND5 can present challenges for soluble expression. Researchers should consider testing multiple expression conditions and fusion tags to optimize yield and solubility. The recombinant protein is typically stored at -20°C, with extended storage at -20°C or -80°C, and repeated freeze-thaw cycles should be avoided to maintain protein integrity .

How can researchers effectively analyze amino acid substitutions in ND5 that correlate with species longevity?

To analyze amino acid substitutions in ND5 that may correlate with species longevity, researchers should follow this methodological approach:

  • Obtain sequence data from both long-lived (e.g., S. franciscanus) and short-lived (e.g., L. variegatus) species through whole genome sequencing or targeted gene sequencing.

  • Construct multiple sequence alignments using software like MUSCLE to compare ND5 sequences across species with varying lifespans.

  • Apply two complementary analytical approaches:

    • First approach: Identify positions containing one amino acid in all long-lived organisms and a different amino acid in all short-lived organisms. Manually validate these positions, focusing on substitutions in regions with good alignment of neighboring positions.

    • Second approach: Group amino acids by similarity (e.g., C, STPAG, NDEQ, HRK, MILV, FYW) and search for positions having amino acids from different groups in long- and short-living organisms .

  • For statistical validation, use computational tools to assess the significance of observed substitutions and their correlation with longevity.

  • Validate findings through experimental approaches such as site-directed mutagenesis and functional assays to determine the impact of identified substitutions on protein function.

This methodology has been successfully applied in comparative genomic studies of sea urchins with different lifespans, yielding insights into potential genetic determinants of longevity .

What experimental considerations are important when studying the relationship between ND5 variants and oxidative stress resistance?

When investigating the relationship between Strongylocentrotus franciscanus ND5 variants and oxidative stress resistance, researchers should consider the following experimental design elements:

  • Control of variables: Ensure experimental conditions are carefully controlled, with clear designation of independent and dependent variables. The independent variable (e.g., ND5 variant) should be systematically altered while the dependent variable (e.g., oxidative stress markers) is measured3.

  • Appropriate stress induction: Select oxidative stress induction methods relevant to mitochondrial function, such as exposure to hydrogen peroxide, paraquat, or hypoxia-reoxygenation models.

  • Multiple assessment methods: Employ diverse methods to assess oxidative stress resistance:

    • Measure ROS production using fluorescent probes

    • Quantify oxidative damage markers (protein carbonylation, lipid peroxidation)

    • Assess mitochondrial membrane potential

    • Determine cell viability under stress conditions

  • Time-course experiments: Evaluate immediate responses and long-term adaptations to oxidative stress.

  • Data analysis without bias: Analyze experimental data objectively, avoiding bias toward expected results. Share data with other researchers to ensure reproducibility, as non-reproducible results cannot reliably support hypotheses3.

These experimental considerations are essential for rigorous scientific investigation of the functional implications of ND5 variants in oxidative stress resistance mechanisms.

How should researchers optimize protein extraction protocols for S. franciscanus ND5?

Optimizing protein extraction protocols for Strongylocentrotus franciscanus NADH-ubiquinone oxidoreductase chain 5 requires careful consideration of its membrane-bound nature and mitochondrial localization. Researchers should follow this methodology:

  • Tissue selection: Use gonad tissue from female specimens, which has been successfully used for genomic DNA preparation in previous studies .

  • Mitochondrial isolation: Perform differential centrifugation to isolate intact mitochondria prior to protein extraction.

  • Membrane protein solubilization: Test multiple detergents for optimal solubilization:

    • Mild detergents (e.g., digitonin, DDM) for maintaining protein-protein interactions

    • Stronger detergents (e.g., Triton X-100, SDS) for maximizing yield

  • Buffer optimization: Include components that maintain protein stability:

    • Protease inhibitors to prevent degradation

    • Glycerol (50%) for stability

    • Tris-based buffer at appropriate pH

  • Purification strategy: Implement a two-step purification:

    • Initial capture by affinity chromatography

    • Secondary purification by size exclusion or ion exchange chromatography

  • Quality assessment: Verify protein integrity through SDS-PAGE, Western blotting, and activity assays.

This optimized protocol accounts for the specific challenges of working with mitochondrial membrane proteins and increases the likelihood of obtaining functional ND5 protein for subsequent analyses.

What are the recommended methods for studying the function of recombinant ND5 in vitro?

For studying the function of recombinant Strongylocentrotus franciscanus NADH-ubiquinone oxidoreductase chain 5 in vitro, the following methodological approaches are recommended:

  • Enzymatic activity assays:

    • NADH dehydrogenase activity measurement using spectrophotometric methods

    • Electron transfer efficiency quantification with artificial electron acceptors

    • Oxygen consumption rates in reconstituted systems

  • Proteoliposome reconstitution:

    • Incorporation of purified recombinant ND5 into liposomes

    • Assessment of proton pumping activity using pH-sensitive fluorescent dyes

    • Measurement of membrane potential generation

  • Protein-protein interaction studies:

    • Pull-down assays to identify interaction partners

    • Blue native PAGE to assess complex formation

    • Crosslinking studies to capture transient interactions

  • Structural characterization:

    • Circular dichroism to assess secondary structure content

    • Limited proteolysis to identify domain boundaries

    • Intrinsic fluorescence to monitor conformational changes

  • Redox state analysis:

    • Determination of midpoint potentials of redox-active centers

    • Reactivity with various substrates and inhibitors

    • Effects of oxidative modifications on activity

Each method should be thoroughly validated using appropriate controls, including known inhibitors of complex I activity and comparison with native mitochondrial preparations. This comprehensive approach allows for detailed characterization of ND5 function in the context of energy metabolism and mitochondrial physiology.

How can researchers effectively analyze ND5 sequence variations between different sea urchin populations?

To effectively analyze NADH-ubiquinone oxidoreductase chain 5 sequence variations between different sea urchin populations, researchers should implement this systematic approach:

  • Sample collection and sequencing:

    • Collect samples from diverse geographical populations

    • Extract mitochondrial DNA following established protocols for sea urchins

    • Perform targeted sequencing of the ND5 gene or incorporate it within whole mitochondrial genome sequencing

  • Sequence alignment and variant calling:

    • Use specialized software (e.g., MUSCLE) for multiple sequence alignments

    • Identify single nucleotide polymorphisms (SNPs) and insertion/deletion variants

    • Filter variants based on quality scores and coverage depth

  • Population genetic analysis:

    • Calculate nucleotide diversity (π) and sequence divergence between populations

    • Perform neutrality tests (Tajima's D, Fu's Fs) to detect selection signatures

    • Construct haplotype networks to visualize relationships between variants

  • Functional prediction:

    • Map variants onto protein structure to assess potential functional impact

    • Classify variants as synonymous or non-synonymous

    • Use conservation scores to prioritize variants for functional studies

  • Correlation with environmental factors:

    • Analyze associations between variant frequencies and environmental parameters

    • Perform statistical tests to identify significant correlations

    • Apply geospatial analysis to detect potential adaptation patterns

This methodological framework allows researchers to comprehensively characterize ND5 genetic diversity across sea urchin populations and generate hypotheses about the functional and evolutionary significance of observed variations.

What statistical approaches are most appropriate for analyzing ND5 sequence data in relation to longevity studies?

When analyzing NADH-ubiquinone oxidoreductase chain 5 sequence data in relation to longevity studies, researchers should employ the following statistical approaches:

  • Phylogenetic comparative methods:

    • Construct phylogenetic trees incorporating species with known lifespan data

    • Apply phylogenetically independent contrasts to account for evolutionary relationships

    • Use ancestral state reconstruction to infer evolutionary changes in both sequence and lifespan

  • Correlation analysis:

    • Group species by longevity categories (e.g., short-lived, medium-lived, long-lived)

    • Correlate specific amino acid positions with longevity metrics

    • Apply multiple testing corrections to control false discovery rate

  • Machine learning approaches:

    • Implement supervised learning algorithms to identify sequence patterns associated with longevity

    • Use feature selection methods to identify the most informative amino acid positions

    • Validate predictions through cross-validation and testing on independent datasets

  • Protein structure-based analysis:

    • Map amino acid variations onto predicted protein structures

    • Analyze clustering of longevity-associated variants in functional domains

    • Calculate conservation scores within structural contexts

  • Permutation tests:

    • Compare observed correlations between sequence features and longevity against null distributions

    • Generate p-values through randomization of longevity data across the phylogeny

    • Establish significance thresholds appropriate for multiple testing scenarios

This statistical framework has been successfully applied in comparative genomic studies of sea urchins with different lifespans, where researchers identified amino acid residues specific for longevity groups and clustered proteins containing these residues based on their function .

How might findings from S. franciscanus ND5 research contribute to our understanding of mitochondrial function in aging?

Research on Strongylocentrotus franciscanus NADH-ubiquinone oxidoreductase chain 5 offers significant insights into mitochondrial function in aging due to several unique attributes of this model system:

  • Exceptional longevity model: S. franciscanus represents an extraordinary longevity model with a lifespan exceeding a century, while closely related species like L. variegatus live only about four years . This natural experiment provides a powerful comparative framework for identifying genetic determinants of longevity.

  • Mitochondrial efficiency hypothesis: ND5, as a component of respiratory Complex I, is central to mitochondrial energy production. Comparative studies of ND5 sequence and function between long-lived and short-lived sea urchins can illuminate how modifications in electron transport chain components might enhance mitochondrial efficiency or reduce reactive oxygen species production in long-lived species.

  • Evolutionary adaptation insights: The identified amino acid substitutions that correlate with longevity may represent evolutionary adaptations that optimize mitochondrial function for extended lifespan . These adaptations could reveal novel mechanisms for maintaining mitochondrial integrity during aging.

  • Translational implications: Understanding how natural variations in ND5 contribute to species longevity differences could inform therapeutic strategies aimed at improving mitochondrial function in age-related human diseases. The identification of specific amino acid residues that correlate with longevity provides potential targets for intervention .

This research contributes to the broader field of aging biology by providing a unique comparative framework for studying natural adaptations that promote exceptional longevity through optimized mitochondrial function.

What are the future research directions for investigating ND5 roles in oxidative stress resistance mechanisms?

Future research on Strongylocentrotus franciscanus NADH-ubiquinone oxidoreductase chain 5 and its role in oxidative stress resistance mechanisms should pursue the following promising directions:

  • Structure-function analysis of longevity-associated variants:

    • Engineer recombinant ND5 proteins with specific amino acid substitutions identified in longevity studies

    • Assess their impact on ROS production, proton pumping efficiency, and response to oxidative stressors

    • Determine whether these variants confer protective advantages under stress conditions

  • Integration with other mitochondrial systems:

    • Investigate interactions between ND5 variants and mitochondrial quality control mechanisms

    • Examine potential synergies with antioxidant defense systems

    • Assess impact on mitochondrial dynamics (fusion/fission) and mitophagy

  • Comparative studies across echinoderm radiation:

    • Expand comparative analyses to additional sea urchin and echinoderm species with varying lifespans

    • Identify convergent adaptations in mitochondrial proteins across independently evolved long-lived lineages

    • Construct a more comprehensive model of mitochondrial adaptations to longevity

  • Development of cell-based and in vivo models:

    • Establish cell lines expressing different ND5 variants for functional testing

    • Develop transgenic models to test the impact of ND5 variants on organismal stress resistance

    • Utilize CRISPR-based approaches for precise editing of endogenous ND5 genes

  • Integration with systems biology approaches:

    • Combine ND5 functional studies with transcriptomic, proteomic, and metabolomic analyses

    • Develop computational models of mitochondrial function incorporating ND5 variants

    • Identify broader metabolic networks affected by ND5 sequence variations

These research directions will advance our understanding of how natural variations in this critical mitochondrial protein contribute to stress resistance mechanisms and potentially influence species longevity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.