Recombinant Strongylocentrotus purpuratus ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant S. purpuratus ATP6 is a full-length, His-tagged protein (229 amino acids) expressed in E. coli . It corresponds to the mitochondrially encoded subunit a of ATP synthase (UniProt ID: P15995), which forms part of the F<sub>o</sub> proton channel in oxidative phosphorylation . This recombinant variant enables precise biochemical and structural studies of ATP synthase assembly and function.

Functional Role in ATP Synthase

ATP6 is integral to the F<sub>o</sub> sector of ATP synthase, facilitating proton translocation across mitochondrial membranes. Structural insights include:

  • Membrane Topology: Contains five transmembrane helices (H1–H5) that form a proton-conducting channel at the interface with the c-ring .

  • Proton Translocation: Conserved arginine residues (e.g., aR159 in humans) interact with the c-ring to drive rotational mechanics .

  • Assembly: Stabilizes interactions between the c-ring, peripheral stalk, and F<sub>1</sub> domain .

Biotechnological Production

The recombinant protein is optimized for experimental reproducibility:

  • Reconstitution: Solubilized in sterile water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage at -80°C .

  • Stability: Degrades upon repeated freeze-thaw cycles; single-use aliquots recommended .

5.1. Mechanistic Studies

  • Used to investigate proton channel defects linked to mitochondrial disorders (e.g., Leigh syndrome, neuropathy) .

  • Mutational analyses (e.g., aL156R, aW109R) reveal impacts on ATP synthase assembly and proton leakage .

5.2. Developmental Biology

  • ATP6 mRNA levels decline during early embryogenesis in S. purpuratus, suggesting maternal mRNA contribution, and rebound during gastrulation via zygotic transcription .

Comparative Analysis

ATP6 sequences across vertebrates show evolutionary conservation but species-specific adaptations:

SpeciesSequence FeaturesFunctional Implications
S. purpuratus229-aa length; conserved proton-pathway residuesRobust model for mitochondrial studies
Human (H. sapiens)226-aa length; mutation hotspots (e.g., T8993G)Links to NARP syndrome, Leigh disease
Antarctic icefish (C. gunnari)Extended N-terminal region (12 extra nucleotides)Adaptation to cold environments

Pathological Relevance

Mutations in homologous human ATP6 cause:

  • Neurodegenerative Disorders: Impaired proton flow reduces ATP synthesis by 70–90%, leading to ATPase deficiencies .

  • Disease Models: Recombinant sea urchin ATP6 aids in studying mutation impacts (e.g., aK122E, aS148N) on enzyme stability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Strongylocentrotus purpuratus (Purple sea urchin)
Target Names
ATP6
Target Protein Sequence
MTASILGQFFPETLFFIPMNVFSMAFCLSWLVFIYPVNWAPSRFQSIWLGFRSNILEMIF QNTSPNTAPWAGLIAGVFVLILLVNVLGLFPPYAFQSPTSNISLTYSLGFPLWMAINILG FYLAFNSRLSHLVPQGTPSALIPLMVWIETLSLFAQPIALGLRLAANLTAGHLLIFLLST AIWLLSSSLMISVPILIIFILLFVLEIGVACIQAYVFTALIHFYLQQNI
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This gradient is established by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. ATP synthase subunit a is a key component of the proton channel and may play a direct role in proton translocation across the membrane.
Database Links

KEGG: spu:2652722

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Strongylocentrotus purpuratus ATP synthase subunit a (ATP6) and what is its significance in research?

ATP synthase subunit a (ATP6) is a critical component of the F0 sector of the mitochondrial ATP synthase complex in the purple sea urchin (Strongylocentrotus purpuratus). This protein is essential for proton translocation across the inner mitochondrial membrane, which drives the synthesis of ATP. The recombinant form is a full-length 229 amino acid protein with UniProt ID P15995 .

Sea urchins, including S. purpuratus, serve as valuable model organisms in numerous research fields, including developmental biology, cell homeostasis regulation, and environmental toxicology studies. Their genome contains over 400 genes involved in cell homeostasis regulation, with remarkable evolutionary conservation of sequences . This conservation makes sea urchin proteins like ATP6 valuable for comparative studies with human mitochondrial proteins.

What are the structural features of recombinant S. purpuratus ATP6 protein?

The recombinant S. purpuratus ATP6 protein has the following characteristics:

FeatureDescription
Amino Acid Length229 amino acids (full length, positions 1-229)
Protein SequenceMTASILGQFFPETLFFIPMNVFSMAFCLSWLVFIYPVNWAPSRFQSIWLGFRSNILEMIFQNTSPNTAPWAGLIAGVFVLILLVNVLGLFPPYAFQSPTSNISLTYSLGFPLWMAINILGFYLAFNSRLSHLVPQGTPSALIPLMVWIETLSLFAQPIALGLRLAANLTAGHLLIFLLSTAIWLLSSSLMISVPILIIFILLFVLEIGVACIQAYVFTALIHFYLQQNI
UniProt IDP15995
TagN-terminal His tag
Expression SystemE. coli
Purity>90% as determined by SDS-PAGE

The protein's hydrophobic regions are critical for its integration into the mitochondrial membrane and its function in proton translocation .

How should researchers optimize storage and handling of recombinant S. purpuratus ATP6?

For optimal results when working with recombinant S. purpuratus ATP6:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, aliquot the protein to avoid repeated freeze-thaw cycles

  • For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (commonly 50%) for long-term storage

  • For working stocks, store aliquots at 4°C for up to one week

  • Prior to opening, briefly centrifuge the vial to bring contents to the bottom

These handling procedures help maintain protein stability and functionality for experimental applications such as SDS-PAGE and functional assays.

What methodological approaches are most effective for studying ATP6 phosphorylation and its relation to mitochondrial function?

Research on ATP6 phosphorylation typically employs these methods:

  • 2D-gel electrophoresis followed by LC-MS/MS identification: This approach has successfully identified ATP synthase as a PKA and PKC substrate in sea urchin sperm, along with other mitochondrial proteins such as creatine kinase, NADH dehydrogenase flavoprotein 2, succinyl-CoA ligase, and VDAC2 .

  • Isolation of low-density detergent-insoluble membranes (LD-DIM): This technique is valuable for studying ATP6 in its native membrane environment, as LD-DIM-derived proteins from different sperm motility conditions reveal differential phosphorylation patterns .

  • Comparative analysis of sperm in different motility states: Comparing immotile, motile, and Speract-stimulated sperm provides insights into how ATP6 phosphorylation correlates with functional outcomes like motility .

The finding that 66% of PKA or PKC substrates identified in LD-DIM are mitochondrial proteins suggests that phosphorylation of these proteins, including ATP6, plays a critical role in modulating sea urchin sperm motility by ensuring sufficient energy provision .

How does ATP6 contribute to our understanding of mitochondrial bioenergetics and sperm motility?

ATP6 is fundamental to mitochondrial energy production and thus to cellular functions requiring high energy expenditure, such as sperm motility. Research has established that:

  • ATP synthase is among the mitochondrial proteins that change phosphorylation state during the transition from immotile to motile sperm, suggesting a regulatory role in energy production for motility .

  • Phosphorylation events triggered by Speract (a sperm-activating peptide) appear to modulate the activity of mitochondrial proteins, including ATP6, to provide sufficient energy for sperm physiology and motility .

  • These protein modifications occur in specific membrane microdomains (LD-DIM), indicating a spatial organization of this regulatory mechanism .

Understanding these processes provides insights into both reproduction biology and fundamental mitochondrial bioenergetics with potential implications for human mitochondrial disorders.

Why is the sea urchin ATP6 valuable for comparative studies with human mitochondrial diseases?

The sea urchin ATP6 serves as an excellent model for comparative studies with human mitochondrial diseases for several reasons:

  • Evolutionary conservation: Sea urchin mitochondrial proteins show remarkable sequence conservation with human counterparts, making them relevant models for human disease studies .

  • Disease relevance: Mutations in human MT-ATP6 cause serious mitochondrial disorders including Leigh Syndrome and NARP (Neurogenic Ataxia with Retinitis Pigmentosa), characterized by decreased ATP synthesis and abnormal mitochondrial membrane potential .

  • Experimental advantages: Sea urchins produce large quantities of gametes, have well-characterized development, and are frequently used in toxicology and environmental health sciences .

  • Translational value: Mechanistic insights from sea urchin ATP6 studies may inform therapeutic approaches for human MT-ATP6-related diseases, where variants produce diverse biochemical features including reduced ATP synthesis rates, preserved ATP hydrolysis capacity, and increased mitochondrial membrane potential .

How does assembly-dependent translation regulation of ATP6 operate, and what are its implications for research?

Recent research reveals sophisticated regulatory mechanisms controlling ATP6 translation:

  • Assembly-coupled translation: The synthesis of ATP6 is coupled to its incorporation into the ATP synthase complex, suggesting a feedback mechanism that prevents wasteful production of unassembled subunits .

  • Regulatory model: When assembly of ATP synthase stalls at the point where ATP6 should be incorporated, the cell accelerates the rate of ATP6 translation. This represents a quality control mechanism ensuring the availability of components needed to complete assembly .

  • F1 dependence: The translation stimulation of assembly-defective ATP6 variants depends on the presence of the F1 sector of ATP synthase, indicating cross-talk between different parts of the complex during assembly .

  • Late incorporation: ATP6 is incorporated relatively late in the ATP synthase assembly process, which explains why partial assembly intermediates can influence ATP6 translation .

These findings challenge the conventional view of mitochondrial protein synthesis and assembly, suggesting more complex regulatory mechanisms than previously appreciated. For researchers, this implies that experimental manipulations affecting ATP synthase assembly may indirectly impact ATP6 translation rates, potentially confounding experimental results if not accounted for.

What insights can mutational analysis of ATP6 provide for mitochondrial disease research?

Mutational analysis of ATP6 offers valuable insights into mitochondrial disease mechanisms:

  • Heteroplasmy-phenotype correlations: Analysis of MT-ATP6 variants reveals that heteroplasmy load (proportion of mutated mitochondrial DNA) correlates significantly with disease severity. Higher heteroplasmy levels are associated with earlier-onset phenotypes .

  • Biochemical diversity: Different MT-ATP6 variants result in distinct biochemical profiles, suggesting variant-specific pathogenic mechanisms:

VariantBiochemical FeaturesProposed Mechanism
m.9176T>GDecreased ATP synthesis (malate > succinate), normal response to oligomycin, increased mitochondrial membrane potentialImpaired proton pumping efficiency with normal holocomplex
m.9185T>CDecreased mitochondrial membrane potential, impaired CV holoenzyme assembly, decreased ATP hydrolysis, normal ATP synthesisImpairment of proton pump
  • Mechanistic heterogeneity: No single biochemical feature is universally observed across all pathogenic variants, highlighting the complexity of ATP6 function and the multiple ways in which its disruption can lead to disease .

This heterogeneity underscores the importance of comprehensive biochemical characterization when studying novel ATP6 variants and suggests that therapeutic approaches may need to be tailored to specific variant mechanisms.

What are the primary technical challenges in expressing and purifying recombinant S. purpuratus ATP6, and how can they be addressed?

Recombinant expression of membrane proteins like ATP6 presents several challenges:

  • Hydrophobicity: As an integral membrane protein, ATP6 contains multiple hydrophobic domains that can lead to misfolding, aggregation, or toxicity to the expression host. Solution: Use of E. coli strains optimized for membrane protein expression and addition of solubilizing tags (such as the His tag used in the commercial preparation) .

  • Protein folding: Ensuring proper folding in a heterologous expression system. Solution: Careful optimization of expression conditions including temperature, induction time, and inducer concentration.

  • Protein solubility: Maintaining solubility during purification. Solution: Use of appropriate detergents or lipid nanodisc systems for membrane protein stabilization after extraction from the cell membrane.

  • Functional assessment: Verifying that the recombinant protein retains its native function. Solution: Development of specific functional assays that can be performed in reconstituted systems.

The commercial preparation described in the search results is expressed in E. coli and purified to >90% purity, suggesting these challenges have been successfully addressed for research applications .

What methodological approaches can researchers use to study the functional integration of ATP6 into the ATP synthase complex?

To study ATP6 integration into the ATP synthase complex, researchers can employ several complementary approaches:

  • Blue Native-PAGE (BN-PAGE): This technique allows visualization of the intact ATP synthase complex and assembly intermediates, enabling researchers to assess whether mutant forms of ATP6 are properly incorporated.

  • Assembly-dependent translation assays: Based on the finding that translation of subunit 6 is enhanced in assembly-defective mutants, researchers can use this phenomenon to assess the efficiency of ATP6 incorporation into the complex .

  • Mitochondrial membrane potential measurements: Since ATP6 is critical for the proton channel function of ATP synthase, measuring membrane potential using fluorescent dyes can provide insights into whether ATP6 is functionally integrated .

  • ATP synthesis and hydrolysis assays: Comparing these activities provides information about the coupling efficiency of the ATP synthase complex, which depends on proper ATP6 integration and function .

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation or crosslinking followed by mass spectrometry can identify the interaction partners of ATP6 during the assembly process.

These methods collectively provide a comprehensive picture of both the structural incorporation and functional contribution of ATP6 to the ATP synthase complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.