Recombinant Strongylocentrotus purpuratus Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Strongylocentrotus purpuratus (Purple sea urchin)
Target Names
COII
Target Protein Sequence
MGTWAQFGLQDASSPLMEELTYFHDYALIVLTLITILVFYGLVSLLVSSNTNRFFFEGQE LETIWTVIPALILILIALPSLQLLYLMDEVNDPFLTIKAFGHQWYWSYEYTDFNDLEFDS YMVPTSDVSFGNPRLLEVDNRLVLPMQNPIRVLVSSADVLHSWAVPSLGTKMDAVPGRLN QTTFFAARTGVFYGQCSEICGANHSFMPIVIESVPFNTFENWVTQYLEE
Uniprot No.

Target Background

Function
Recombinant *Strongylocentrotus purpuratus* Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC, formed by heme A3 and copper B, CuB) in subunit 1. The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Database Links

KEGG: spu:2652720

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Strongylocentrotus purpuratus Cytochrome c oxidase subunit 2?

Strongylocentrotus purpuratus Cytochrome c oxidase subunit 2 (COII) is a mitochondrial protein that functions as part of the electron transport chain. Like many proteins from the purple sea urchin, it may exhibit structural flexibility, potentially existing in different conformational states depending on environmental conditions. This structural flexibility is similar to what has been observed in other S. purpuratus proteins, such as the Sp185/333 (now called SpTransformer) protein family, which can transform from disordered (random coil) to α-helical structures . Bioinformatic analysis would be required to determine if COII shares the intrinsically disordered regions characteristic of these immune response proteins.

How does S. purpuratus COII function in the electron transport chain?

S. purpuratus COII functions as part of Complex IV in the mitochondrial electron transport chain, similar to COII in other eukaryotes. It accepts electrons from cytochrome c and helps transfer them to molecular oxygen, contributing to the proton gradient that drives ATP synthesis. The specific characteristics of S. purpuratus COII may be influenced by the organism's adaptation to variable marine environments and its unique physiology as a key grazer in coastal ecosystems . Research approaches studying this function would benefit from experimental designs that examine protein-protein interactions and electron transfer kinetics under different physiological conditions.

How does S. purpuratus COII differ from COII in other marine invertebrates?

While the search results don't provide specific comparative data, researchers should approach this question by examining evolutionary conservation patterns in COII across marine invertebrates. S. purpuratus, as a key grazer in coastal ecosystems , may have evolved specific adaptations in its respiratory proteins. Addressing this question would require multiple sequence alignments, phylogenetic analyses, and structural modeling. The unique gut microbiome of S. purpuratus identified in microbiome studies may also influence the selective pressures on mitochondrial proteins, potentially contributing to functional differences.

What expression systems are most effective for recombinant S. purpuratus COII production?

For effective recombinant expression of S. purpuratus COII, researchers should consider Escherichia coli expression systems that have been optimized through experimental design approaches. Statistical experimental design methodologies that evaluate responses by changing multiple variables simultaneously have proven effective for other recombinant proteins . This multivariant approach allows for the estimation of statistically significant variables while accounting for interactions between them. For membrane proteins like COII, modifications may be necessary to promote soluble expression, potentially including fusion tags or specialized E. coli strains. Researchers should implement a factorial design to optimize temperature, inducer concentration, media composition, and expression time.

What purification strategies yield the highest purity of recombinant S. purpuratus COII?

Purification of recombinant S. purpuratus COII likely requires a multi-step approach to achieve high purity while maintaining functional integrity. Based on experimental design principles used for other recombinant proteins, researchers should develop a purification protocol that may include affinity chromatography (using appropriate tags), ion exchange chromatography, and size exclusion chromatography . The protocol should be optimized using statistical methods to evaluate the impact of different buffer conditions, pH values, and salt concentrations on protein yield and purity. As seen with other recombinant proteins, it is possible to achieve up to 75% homogeneity while maintaining functional activity .

How can factorial design improve the soluble expression of recombinant S. purpuratus COII?

Factorial design can significantly improve soluble expression of recombinant S. purpuratus COII by systematically evaluating the effects of multiple variables and their interactions. This approach allows researchers to identify optimal conditions with fewer experiments and minimal resources . For COII expression, the following factorial design could be implemented:

FactorLow Level (-1)High Level (+1)
Temperature18°C37°C
IPTG concentration0.1 mM1.0 mM
Expression time4 hours24 hours
Media typeLBTB
Oxygen levelLowHigh

Researchers should analyze the results using statistical software to identify significant main effects and interactions. This methodology has enabled high levels (250 mg/L) of soluble expression of other recombinant proteins in E. coli , and similar approaches should be applied to optimize COII expression. The multivariant method enables characterization of experimental error and comparison of variable effects when normalized, gathering high-quality information with minimal experiments.

What are the most effective methods for assessing functional integrity of recombinant S. purpuratus COII?

Assessing functional integrity of recombinant S. purpuratus COII requires a combination of biochemical, biophysical, and enzymatic approaches. Researchers should develop assays that measure:

  • Electron transfer activity: Using artificial electron donors and acceptors to measure the rate of electron transfer

  • Spectroscopic properties: Examining absorption spectra to confirm proper incorporation of heme groups

  • Structural integrity: Using circular dichroism (CD) analysis similar to that used for SpTransformer proteins to determine if the recombinant protein adopts the expected secondary structure

  • Binding assays: Testing interaction with natural binding partners

Researchers should be aware that, as demonstrated with SpTransformer proteins, recombinant proteins can undergo structural transformations depending on solution conditions . Therefore, functional assays should be performed under a range of physiologically relevant conditions.

How does the native environment affect S. purpuratus COII structure and function?

The native environment likely plays a crucial role in S. purpuratus COII structure and function. S. purpuratus inhabits various marine ecosystems, and research has shown that habitat significantly influences the microbiome and physiological responses of these sea urchins . Researchers investigating this question should consider:

  • The effect of temperature fluctuations characteristic of intertidal environments

  • The impact of pH variations, especially in the context of ocean acidification

  • The influence of the gut microbiome, which varies with habitat and resource availability

  • The potential structural transformations that may occur in response to environmental stressors, similar to those observed in SpTransformer proteins

Experimental approaches should include comparative analyses of COII from S. purpuratus collected from different habitats, combined with in vitro studies that simulate various environmental conditions.

What role does S. purpuratus COII play in the organism's adaptation to environmental stressors?

S. purpuratus COII likely plays a significant role in adaptation to environmental stressors, particularly those affecting energy metabolism. As a component of the respiratory chain, COII is central to energy production and may be subject to selection pressures in response to variable environments. Researchers examining this question should consider:

  • How COII expression and activity changes under thermal stress, hypoxia, or pH stress

  • Whether there are isoforms or post-translational modifications of COII that enhance function under stress conditions

  • The relationship between COII function and the ecological success of S. purpuratus in various habitats

S. purpuratus is known to survive a variety of conditions and diets, enhancing its ecological impact on kelp forests and other ecosystems . This adaptability may be partially attributable to metabolic flexibility, in which COII could play a crucial role. Research approaches should combine molecular analyses with ecological studies to link COII characteristics to organismal performance in different environments.

How can site-directed mutagenesis elucidate crucial functional residues in S. purpuratus COII?

Site-directed mutagenesis represents a powerful approach to identify critical functional residues in S. purpuratus COII. Researchers should follow a systematic methodology:

  • Perform comparative sequence analysis across echinoderm species to identify conserved residues

  • Generate a structural model of S. purpuratus COII to predict residues involved in electron transfer, proton translocation, or protein-protein interactions

  • Design mutations targeting these residues, using the following approach:

    • Conservative substitutions to test the importance of specific chemical properties

    • Radical substitutions to completely disrupt function

    • Introduction of reporter groups for spectroscopic studies

  • Express and purify mutant proteins using optimized protocols based on experimental design approaches

  • Assess the impact of mutations on structure (using CD spectroscopy) and function (using activity assays)

This systematic approach will generate a comprehensive map of structure-function relationships in S. purpuratus COII, potentially identifying unique features compared to COII from other organisms.

What proteomics approaches are most informative for studying post-translational modifications of S. purpuratus COII?

For studying post-translational modifications (PTMs) of S. purpuratus COII, researchers should employ a multi-faceted proteomics approach:

  • Sample preparation:

    • Extract mitochondria from different tissues and under various environmental conditions

    • Enrich for COII using immunoprecipitation or targeted purification

  • Mass spectrometry analysis:

    • Use a combination of bottom-up and top-down proteomics

    • Employ electron transfer dissociation (ETD) for improved identification of labile PTMs

    • Apply targeted methods like parallel reaction monitoring (PRM) for quantitative analysis

  • Data analysis:

    • Utilize specialized software for PTM identification

    • Apply statistical validation to minimize false discoveries

    • Correlate PTM patterns with environmental variables and physiological states

  • Functional validation:

    • Generate recombinant COII with and without identified PTMs

    • Assess the impact of PTMs on protein structure and function

    • Develop site-specific antibodies to monitor PTMs in vivo

This comprehensive approach will reveal how S. purpuratus regulates COII function through post-translational modifications in response to changing environmental conditions.

How does S. purpuratus COII contribute to the species' ecological success in diverse marine habitats?

S. purpuratus thrives in diverse marine habitats, from kelp forests to urchin barrens, suggesting that its metabolic processes, including COII function, contribute to its ecological adaptability . Researchers investigating this question should adopt an integrated approach:

  • Compare COII sequence, expression, and activity across populations from different habitats

  • Correlate COII characteristics with metabolic rates and thermal tolerance

  • Examine how COII interacts with the distinct gut microbiomes that S. purpuratus maintains across different habitats

  • Investigate whether COII properties correlate with the species' ability to survive on different diets and in different environmental conditions

This research would contribute to understanding how a fundamental cellular component like COII may influence the ecological role of S. purpuratus as a key grazer in coastal marine ecosystems .

What evolutionary pressures have shaped S. purpuratus COII compared to other echinoderms?

Evolutionary analysis of S. purpuratus COII should focus on identifying signatures of selection and adaptative evolution. Researchers should:

  • Perform comprehensive phylogenetic analyses of COII across echinoderm lineages

  • Calculate dN/dS ratios to identify sites under positive selection

  • Correlate evolutionary changes with ecological niches and environmental parameters

  • Use ancestral sequence reconstruction to understand the functional consequences of evolutionary changes

This approach will reveal whether the unique ecological role of S. purpuratus as a key grazer in coastal seas has influenced the evolution of its energy metabolism components, including COII. The research may uncover whether adaptive evolution of COII contributes to the species' ability to survive a variety of conditions and diets, enhancing its ecological impact on kelp forests and other ecosystems .

How does S. purpuratus COII interact with the organism's immune system components?

Understanding the potential interaction between S. purpuratus COII and immune system components requires exploring potential cross-talk between mitochondrial and immune functions. While this isn't directly addressed in the search results, researchers can approach this question by investigating:

  • Whether respiratory complexes containing COII are targets of immune recognition during cellular stress

  • If COII-derived peptides play any role in immune signaling

  • How mitochondrial function, particularly COII activity, changes during immune challenges

The S. purpuratus immune system includes the diverse SpTransformer protein family (formerly Sp185/333) that shows remarkable binding flexibility and structural adaptability . Researchers should explore whether there are functional interactions between these immune proteins and mitochondrial components like COII, particularly under stress conditions.

What is the relationship between S. purpuratus COII and the organism's gut microbiome?

The relationship between S. purpuratus COII and the gut microbiome represents an intriguing area of research at the intersection of cellular metabolism and microbial ecology. Research has shown that S. purpuratus maintains a distinct gut microbiome that varies with habitat and likely facilitates digestion and nutrition . To investigate potential relationships with COII, researchers should:

  • Examine whether gut microbiome composition correlates with COII expression or activity

  • Investigate whether microbial metabolites influence mitochondrial function

  • Determine if changes in COII activity (through experimental manipulation) affect the gut microbiome composition

  • Explore whether the microbiome contributes to the sea urchin's metabolic flexibility across different environmental conditions

This research would contribute to understanding how host-microbiome interactions influence fundamental cellular processes like respiration, potentially explaining aspects of S. purpuratus ecological success .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.