Strongylocentrotus purpuratus, commonly known as the purple sea urchin, is a marine echinoderm widely used as a model organism in developmental and molecular biology research. This species has gained significant attention in the scientific community due to its well-characterized genome and its importance in evolutionary studies. The NADH-ubiquinone oxidoreductase chain 3 (ND3) protein isolated from this organism represents an essential component of the mitochondrial electron transport chain. This protein is encoded by the mitochondrial genome and has been characterized through various biochemical and molecular techniques. The recombinant form of this protein has been developed to facilitate research investigations that require purified protein samples for structural and functional analyses .
Recombinant Strongylocentrotus purpuratus NADH-ubiquinone oxidoreductase chain 3 is identified in protein databases with the UniProt accession number P15550. The protein consists of 116 amino acid residues and functions as a subunit of the larger NADH dehydrogenase complex (Complex I) in the mitochondrial respiratory chain. The amino acid sequence of this protein has been fully determined and is characterized by its hydrophobic nature, reflecting its membrane-embedded location within the mitochondrion. The recombinant form of this protein is typically produced with specific tags to facilitate purification and detection in experimental settings .
The primary structure of Strongylocentrotus purpuratus NADH-ubiquinone oxidoreductase chain 3 consists of a 116-amino acid sequence as follows:
"MTTIIFLFSITIAVAVVLGLAAHALPNRTSDSEKSSPYECGFDPLNSARLPFSFRFFLVA ILFLLFDLEIALLFPLPAASLITPPSTLIPISMVFMVILTLGLVFEWINGGLEWAE"
This sequence reveals a protein rich in hydrophobic amino acids, consistent with its role as a membrane-embedded subunit. Analysis of this sequence shows multiple transmembrane domains that anchor the protein within the inner mitochondrial membrane. The hydrophobic character of many regions in this sequence is crucial for proper positioning within the lipid bilayer and for interactions with other components of the respiratory complex.
While specific information about the S. purpuratus ND3 is limited in the available research, we can understand its function by examining related NADH-ubiquinone oxidoreductase proteins. The ND3 protein serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This complex is believed to be part of the minimal assembly required for catalysis in the electron transport chain. Complex I functions in the critical transfer of electrons from NADH to the respiratory chain, with ubiquinone serving as the immediate electron acceptor for the enzyme . This electron transfer process is coupled with proton pumping across the inner mitochondrial membrane, contributing to the generation of the proton gradient that drives ATP synthesis.
Recombinant Strongylocentrotus purpuratus NADH-ubiquinone oxidoreductase chain 3 is typically produced using bacterial expression systems, particularly Escherichia coli. This approach allows for high-yield production of the protein for research applications. While specific expression details for S. purpuratus ND3 are not provided in the search results, we can draw parallels from the production of related proteins such as ND4L from the same organism. The expression process likely involves cloning the coding sequence into a suitable expression vector, transforming the construct into bacterial cells, inducing protein expression, and then purifying the recombinant protein using affinity chromatography based on the attached tag .
Another related protein from S. purpuratus is NADH-ubiquinone oxidoreductase chain 4L (ND4L), which also functions as part of the mitochondrial respiratory chain. The ND4L protein consists of 97 amino acids, making it slightly smaller than ND3. The amino acid sequence of ND4L (MALLIVILSMFYLGLMGILLNRLHFLSILLCLELLLISLFIGIAIWNNNTGVPQNTTFNL FVLTLVACEASIGLSLMVGLSRTHSSNLVGSLSLLQY) shows a similar hydrophobic profile consistent with its membrane localization .
Table 2: Comparison of S. purpuratus ND3 with Related Proteins
| Feature | S. purpuratus ND3 | P. ochraceus ND3 | S. purpuratus ND4L |
|---|---|---|---|
| UniProt ID | P15550 | P24997 | P15554 |
| Length | 116 amino acids | Not specified in search results | 97 amino acids |
| Function | NADH dehydrogenase subunit | NADH dehydrogenase subunit | NADH dehydrogenase subunit |
| Complex | Mitochondrial Complex I | Mitochondrial Complex I | Mitochondrial Complex I |
| Location | Inner mitochondrial membrane | Inner mitochondrial membrane | Inner mitochondrial membrane |
| Enzyme Classification | EC 1.6.5.3 | EC 7.1.1.2 | Not specified in search results |
The recombinant ND3 protein can be utilized in enzymatic assays to study the electron transfer capabilities of Complex I. Such studies are important for understanding mitochondrial function in both normal and pathological conditions. Furthermore, the protein may serve as an antigen for antibody production, which can be used in immunological detection methods such as Enzyme-Linked Immunosorbent Assay (ELISA) . This application is valuable for quantifying the expression levels of ND3 in various experimental settings or for detecting abnormalities in its expression.
S. purpuratus ND3 provides an excellent model for evolutionary studies of mitochondrial proteins. By comparing the structure and function of this protein with homologs from other species, researchers can gain insights into the evolutionary conservation of mitochondrial respiratory complexes. Such comparative analyses can reveal which regions of the protein are most critical for function, based on their conservation across species, and which regions have undergone species-specific adaptations.
KEGG: spu:2652723
What is the structure and function of ND3 in sea urchin mitochondrial complex I?
ND3 is a critical subunit of mitochondrial respiratory chain complex I that catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. In sea urchins like Strongylocentrotus purpuratus, ND3 is encoded by the mitochondrial genome and is essential for complex I catalytic activity.
Research indicates that ND3 contains key functional elements including the Cys39 residue (using mammalian numbering), which plays an important role in the active/deactive transition of complex I. During this transition, Cys39 becomes exposed in the deactive state and is occluded in the active state . In sea urchins, mitochondrial genes like ND3 typically use TAG as a stop codon, as observed in related species such as Tripneustes gratilla .
Methodologically, researchers can study ND3 structure through techniques such as:
X-ray crystallography of purified complex I
Cryo-electron microscopy
Computer modeling based on homology with known structures
Mass spectrometry analysis of post-translational modifications
How can recombinant S. purpuratus ND3 be effectively expressed in E. coli systems?
Expressing hydrophobic mitochondrial membrane proteins like ND3 in bacterial systems presents several challenges. Based on successful expression of other sea urchin recombinant proteins, the following methodological approach is recommended:
Codon optimization: Adjust codon usage to match E. coli preferences while preserving the amino acid sequence of S. purpuratus ND3.
Expression vector selection: Use vectors with strong promoters (T7) and N-terminal tags for detection and purification. For example, His-tagging has been successfully used for other recombinant proteins from sea urchins .
Specialized E. coli strains: Use strains that are tolerant to toxic or membrane proteins, such as C43(DE3), which has been successfully used for other sea urchin recombinant proteins .
Expression conditions:
Grow at lower temperatures (16-18°C) after induction
Use lower IPTG concentrations (0.1-0.5 mM) for induction
Include membrane-stabilizing additives in the growth medium
Post-expression processing: Lyophilize the purified protein and store with 6% Trehalose in Tris/PBS-based buffer at pH 8.0 .
The amino acid sequence of expressed protein should be verified using mass spectrometry, and proper folding can be assessed through circular dichroism analysis.
What purification methods are most effective for recombinant sea urchin mitochondrial proteins?
Purification of recombinant mitochondrial proteins from sea urchins requires specialized techniques due to their hydrophobic nature and tendency to form inclusion bodies. Based on successful purification of other sea urchin recombinant proteins, the following methods are recommended:
Immobilized Metal Affinity Chromatography (IMAC): If the recombinant ND3 contains a His-tag, use Ni-NTA columns under denaturing conditions (6-8M urea or 6M guanidine-HCl) followed by on-column refolding.
Detergent solubilization: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) to maintain protein solubility.
Size-Exclusion Chromatography: Apply as a polishing step to separate monomeric from aggregated forms and remove remaining impurities.
Ion Exchange Chromatography: Particularly useful for removing nucleic acid contaminants that often co-purify with positively charged mitochondrial proteins.
Purity assessment should be performed using SDS-PAGE and Western blotting with anti-His antibodies, with expected purity greater than 90% . During reconstitution, the protein should be diluted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added as a stabilizer for long-term storage at -20°C/-80°C .
How does ND3 gene polymorphism affect protein function in sea urchin populations?
ND3 polymorphism in sea urchin populations can have significant functional implications for protein function and mitochondrial activity. Research on related sea urchin species has revealed:
Methodologically, researchers can study these polymorphisms through:
PCR amplification of mitochondrial genes from different populations
Sequencing and bioinformatic analysis to identify variants
Expression of variant proteins to assess functional differences
Biochemical assays to measure electron transport efficiency
How can CRISPR/Cas9 genome editing be applied to study ND3 function in S. purpuratus?
CRISPR/Cas9 has been successfully applied in sea urchin research and can be adapted to study mitochondrial genes like ND3, though with additional considerations due to the mitochondrial location. A methodological approach would include:
gRNA design: Design multiple gRNAs targeting the ND3 gene sequence. In S. purpuratus, CRISPR/Cas9 targeting has shown high efficiency (60-80% of injected embryos) with 67-100% of sequenced clones containing indels at target sites when multiple gRNAs are used .
Delivery method: For mitochondrial targeting, specialized approaches are needed:
Mitochondria-targeted Cas9 (mtCas9) with mitochondrial localization sequences
Delivery of Cas9-gRNA ribonucleoprotein complexes to eggs via microinjection, a technique well-established in sea urchin embryology
Validation: Validation of editing can be performed using:
PCR amplification and sequencing of the target region
Quantitative assessment of mutated vs. wild-type mtDNA copies
Functional assays of complex I activity
Phenotypic analysis: In sea urchins, CRISPR-based knockouts of other genes have produced highly penetrant phenotypes (>95% in injected embryos) , suggesting this could be effective for studying ND3 function.
Challenges specific to mitochondrial genome editing include:
What role does the conserved Cys39 residue play in S. purpuratus ND3, and how can it be studied?
The Cys39 residue in ND3 has been identified as a critical element in complex I function, particularly in the active/deactive transition. Recent research has challenged previous assumptions about this process:
Functional significance: Contrary to previous beliefs, studies have shown significant Cys39 exposure during NADH/CoQ oxidoreductase activity, not just in the deactive state .
Redox sensitivity: Alkylation of Cys39 during active respiration does not affect complex I activity, but alkylation of the inactive complex irreversibly blocks reactivation .
To study this in S. purpuratus ND3, researchers can employ:
Site-directed mutagenesis: Create recombinant ND3 variants with Cys39 replaced by serine or alanine.
Isotopic labeling and mass spectrometry: This approach can quantify Cys39 exposure under different conditions by measuring accessibility to labeling reagents .
Functional assays:
Measure NADH/CoQ oxidoreductase activity of complex I with wild-type vs. mutant ND3
Assess sensitivity to redox changes
Test response to ischemia-reperfusion conditions
Structural analysis: Use techniques like cryo-EM to visualize conformational changes associated with Cys39 exposure.
This research has significant implications for understanding the mechanistic details of complex I function in marine invertebrates and its evolutionary conservation.
How do different expression systems affect post-translational modifications of recombinant S. purpuratus ND3?
Post-translational modifications (PTMs) of recombinant proteins are highly dependent on the expression system used. For S. purpuratus ND3, different expression systems offer various advantages:
Bacterial expression (E. coli):
Lacks most eukaryotic PTM machinery
Results in non-glycosylated protein
May require refolding from inclusion bodies
Offers high yield but potentially compromised function
Insect cell expression systems:
Provide glycosylation and other eukaryotic PTMs
Have been successfully used for sea urchin SpTrf proteins, yielding stable, glycosylated products
Results show that insect cell-expressed recombinant proteins are larger than expected due to N-linked glycosylation
Functional studies showed that glycosylated recombinant proteins maintain biological activity when compared to non-glycosylated versions
Yeast expression:
Offers intermediate complexity of PTMs
Can produce properly folded membrane proteins
Lower cost than mammalian systems
Experimental data from studies with recombinant SpTrf proteins demonstrated that proteins expressed in insect cells:
Were more stable compared to non-glycosylated bacterial versions
Maintained functional activity in binding assays
| Expression System | Glycosylation | Protein Stability | Functional Activity | Yield |
|---|---|---|---|---|
| E. coli | None | Lower | Variable | High |
| Insect cells | Yes (N-linked) | Higher | Preserved | Medium |
| Yeast | Yes (modified) | Intermediate | Good | Medium |
What methodologies can be used to study ND3's role in Complex I assembly in sea urchin mitochondria?
Studying the role of ND3 in Complex I assembly in sea urchins requires specialized techniques to address the challenges of working with membrane protein complexes. A comprehensive methodological approach includes:
Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):
Allows visualization of intact respiratory complexes
Can identify assembly intermediates when ND3 is absent or mutated
Different detergents (digitonin, DDM) can be used to maintain complex integrity
Pulse-chase labeling:
Track the incorporation of labeled ND3 into complex I
Monitor assembly kinetics with and without inhibitors
Cryo-electron microscopy:
Determine structural details of complex I with wild-type vs. mutant ND3
Identify interaction interfaces and structural changes
Immunoprecipitation with recombinant tagged-ND3:
Identify protein-protein interactions during assembly
Determine temporal sequence of assembly steps
CRISPR/Cas9-mediated depletion:
Generate sea urchin cells with reduced ND3 levels
Monitor effects on complex I assembly and function
Cellular imaging:
These approaches can reveal how ND3 contributes to the assembly and stability of complex I in sea urchin mitochondria, which may differ from the well-studied mammalian systems.
How can recombinant S. purpuratus ND3 be used to investigate mitochondrial disease mechanisms?
Recombinant S. purpuratus ND3 can serve as a valuable tool for investigating mitochondrial disease mechanisms, particularly those involving complex I dysfunction. Methodological approaches include:
Comparative functional studies:
Express wild-type S. purpuratus ND3 alongside human disease-associated variants
Compare biochemical properties and activity
Use sea urchin ND3 as an evolutionary reference point
Disease-associated mutation modeling:
Complex I reconstitution experiments:
Use purified recombinant ND3 to reconstitute complex I in vitro
Compare activity with human vs. sea urchin components
Identify species-specific differences in function
Redox sensitivity analysis:
Study how the Cys39 residue in recombinant ND3 responds to oxidative stress
Compare with human ND3 responses
Investigate potential protective mechanisms in sea urchins
Drug screening platforms:
Use reconstituted complexes containing recombinant ND3 to screen for compounds that rescue disease-associated phenotypes
Identify conserved mechanisms that could be therapeutic targets
Sea urchins are particularly valuable model systems as they share key features of mitochondrial function with vertebrates while offering experimental advantages such as external fertilization and transparent embryonic development, allowing for real-time observation of mitochondrial dynamics.
What is known about the evolutionary conservation of ND3 across echinoderm species, and how does S. purpuratus ND3 compare?
ND3 shows interesting patterns of evolutionary conservation across echinoderm species, revealing both highly conserved functional domains and species-specific adaptations:
Conservation patterns:
Core functional domains involved in electron transport are highly conserved
The Cys39 residue, critical for the active/deactive transition, is conserved in most species
Mitochondrial genome studies across sea urchin species show that protein-coding genes like ND3 tend to have conserved start and stop codons, with ND3 predominantly using TAG as a stop codon
Polymorphism distribution:
Studies of mitochondrial DNA in sea urchins have identified significant genetic subdivision among geographic locations
In S. purpuratus, population differentiation (mean FST = 0.033 among adults) suggests local adaptation of mitochondrial genes
Some echinoderms show trans-species polymorphism in mitochondrial genes, indicating selection pressures that maintain variation across species boundaries
Comparative analysis:
Complete mitochondrial genome comparisons between different-colored spine morphs of Tripneustes gratilla showed 98.91% similarity , suggesting conservation of mitochondrial genes despite phenotypic differences
Whole mitochondrial genome phylogenetic analysis can effectively differentiate between closely related sea urchin species
Methodological approaches:
PCR amplification using primers designed from conserved regions
Sequence alignment and phylogenetic analysis
Analysis of selection pressures using dN/dS ratios
Structural modeling to identify functionally important residues
Research methodologies for studying ND3 evolution include mitochondrial DNA extraction from spines (a non-destructive method), PCR amplification with primers designed for conserved regions, and shotgun sequencing on instruments like Ion PGM .