Recombinant Strongylocentrotus purpuratus NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Description

Biological origin and classification

Strongylocentrotus purpuratus, commonly known as the purple sea urchin, is a marine echinoderm widely used as a model organism in developmental and molecular biology research. This species has gained significant attention in the scientific community due to its well-characterized genome and its importance in evolutionary studies. The NADH-ubiquinone oxidoreductase chain 3 (ND3) protein isolated from this organism represents an essential component of the mitochondrial electron transport chain. This protein is encoded by the mitochondrial genome and has been characterized through various biochemical and molecular techniques. The recombinant form of this protein has been developed to facilitate research investigations that require purified protein samples for structural and functional analyses .

Molecular identification and characterization

Recombinant Strongylocentrotus purpuratus NADH-ubiquinone oxidoreductase chain 3 is identified in protein databases with the UniProt accession number P15550. The protein consists of 116 amino acid residues and functions as a subunit of the larger NADH dehydrogenase complex (Complex I) in the mitochondrial respiratory chain. The amino acid sequence of this protein has been fully determined and is characterized by its hydrophobic nature, reflecting its membrane-embedded location within the mitochondrion. The recombinant form of this protein is typically produced with specific tags to facilitate purification and detection in experimental settings .

Primary structure and sequence analysis

The primary structure of Strongylocentrotus purpuratus NADH-ubiquinone oxidoreductase chain 3 consists of a 116-amino acid sequence as follows:

"MTTIIFLFSITIAVAVVLGLAAHALPNRTSDSEKSSPYECGFDPLNSARLPFSFRFFLVA ILFLLFDLEIALLFPLPAASLITPPSTLIPISMVFMVILTLGLVFEWINGGLEWAE"

This sequence reveals a protein rich in hydrophobic amino acids, consistent with its role as a membrane-embedded subunit. Analysis of this sequence shows multiple transmembrane domains that anchor the protein within the inner mitochondrial membrane. The hydrophobic character of many regions in this sequence is crucial for proper positioning within the lipid bilayer and for interactions with other components of the respiratory complex.

Functional role in mitochondrial respiration

While specific information about the S. purpuratus ND3 is limited in the available research, we can understand its function by examining related NADH-ubiquinone oxidoreductase proteins. The ND3 protein serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This complex is believed to be part of the minimal assembly required for catalysis in the electron transport chain. Complex I functions in the critical transfer of electrons from NADH to the respiratory chain, with ubiquinone serving as the immediate electron acceptor for the enzyme . This electron transfer process is coupled with proton pumping across the inner mitochondrial membrane, contributing to the generation of the proton gradient that drives ATP synthesis.

Expression systems and purification methods

Recombinant Strongylocentrotus purpuratus NADH-ubiquinone oxidoreductase chain 3 is typically produced using bacterial expression systems, particularly Escherichia coli. This approach allows for high-yield production of the protein for research applications. While specific expression details for S. purpuratus ND3 are not provided in the search results, we can draw parallels from the production of related proteins such as ND4L from the same organism. The expression process likely involves cloning the coding sequence into a suitable expression vector, transforming the construct into bacterial cells, inducing protein expression, and then purifying the recombinant protein using affinity chromatography based on the attached tag .

Comparison with NADH-ubiquinone oxidoreductase chain 4L

Another related protein from S. purpuratus is NADH-ubiquinone oxidoreductase chain 4L (ND4L), which also functions as part of the mitochondrial respiratory chain. The ND4L protein consists of 97 amino acids, making it slightly smaller than ND3. The amino acid sequence of ND4L (MALLIVILSMFYLGLMGILLNRLHFLSILLCLELLLISLFIGIAIWNNNTGVPQNTTFNL FVLTLVACEASIGLSLMVGLSRTHSSNLVGSLSLLQY) shows a similar hydrophobic profile consistent with its membrane localization .

Table 2: Comparison of S. purpuratus ND3 with Related Proteins

FeatureS. purpuratus ND3P. ochraceus ND3S. purpuratus ND4L
UniProt IDP15550P24997P15554
Length116 amino acidsNot specified in search results97 amino acids
FunctionNADH dehydrogenase subunitNADH dehydrogenase subunitNADH dehydrogenase subunit
ComplexMitochondrial Complex IMitochondrial Complex IMitochondrial Complex I
LocationInner mitochondrial membraneInner mitochondrial membraneInner mitochondrial membrane
Enzyme ClassificationEC 1.6.5.3EC 7.1.1.2Not specified in search results

Enzymatic and biomedical applications

The recombinant ND3 protein can be utilized in enzymatic assays to study the electron transfer capabilities of Complex I. Such studies are important for understanding mitochondrial function in both normal and pathological conditions. Furthermore, the protein may serve as an antigen for antibody production, which can be used in immunological detection methods such as Enzyme-Linked Immunosorbent Assay (ELISA) . This application is valuable for quantifying the expression levels of ND3 in various experimental settings or for detecting abnormalities in its expression.

Evolutionary and comparative studies

S. purpuratus ND3 provides an excellent model for evolutionary studies of mitochondrial proteins. By comparing the structure and function of this protein with homologs from other species, researchers can gain insights into the evolutionary conservation of mitochondrial respiratory complexes. Such comparative analyses can reveal which regions of the protein are most critical for function, based on their conservation across species, and which regions have undergone species-specific adaptations.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Strongylocentrotus purpuratus (Purple sea urchin)
Target Names
ND3
Target Protein Sequence
MTTIIFLFSITIAVAVVLGLAAHALPNRTSDSEKSSPYECGFDPLNSARLPFSFRFFLVA ILFLLFDLEIALLFPLPAASLITPPSTLIPISMVFMVILTLGLVFEWINGGLEWAE
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered a crucial component of the minimal assembly required for catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for this enzyme is believed to be ubiquinone.
Database Links

KEGG: spu:2652723

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and function of ND3 in sea urchin mitochondrial complex I?

ND3 is a critical subunit of mitochondrial respiratory chain complex I that catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. In sea urchins like Strongylocentrotus purpuratus, ND3 is encoded by the mitochondrial genome and is essential for complex I catalytic activity.

Research indicates that ND3 contains key functional elements including the Cys39 residue (using mammalian numbering), which plays an important role in the active/deactive transition of complex I. During this transition, Cys39 becomes exposed in the deactive state and is occluded in the active state . In sea urchins, mitochondrial genes like ND3 typically use TAG as a stop codon, as observed in related species such as Tripneustes gratilla .

Methodologically, researchers can study ND3 structure through techniques such as:

  • X-ray crystallography of purified complex I

  • Cryo-electron microscopy

  • Computer modeling based on homology with known structures

  • Mass spectrometry analysis of post-translational modifications

  • How can recombinant S. purpuratus ND3 be effectively expressed in E. coli systems?

Expressing hydrophobic mitochondrial membrane proteins like ND3 in bacterial systems presents several challenges. Based on successful expression of other sea urchin recombinant proteins, the following methodological approach is recommended:

  • Codon optimization: Adjust codon usage to match E. coli preferences while preserving the amino acid sequence of S. purpuratus ND3.

  • Expression vector selection: Use vectors with strong promoters (T7) and N-terminal tags for detection and purification. For example, His-tagging has been successfully used for other recombinant proteins from sea urchins .

  • Specialized E. coli strains: Use strains that are tolerant to toxic or membrane proteins, such as C43(DE3), which has been successfully used for other sea urchin recombinant proteins .

  • Expression conditions:

    • Grow at lower temperatures (16-18°C) after induction

    • Use lower IPTG concentrations (0.1-0.5 mM) for induction

    • Include membrane-stabilizing additives in the growth medium

  • Post-expression processing: Lyophilize the purified protein and store with 6% Trehalose in Tris/PBS-based buffer at pH 8.0 .

The amino acid sequence of expressed protein should be verified using mass spectrometry, and proper folding can be assessed through circular dichroism analysis.

  • What purification methods are most effective for recombinant sea urchin mitochondrial proteins?

Purification of recombinant mitochondrial proteins from sea urchins requires specialized techniques due to their hydrophobic nature and tendency to form inclusion bodies. Based on successful purification of other sea urchin recombinant proteins, the following methods are recommended:

  • Immobilized Metal Affinity Chromatography (IMAC): If the recombinant ND3 contains a His-tag, use Ni-NTA columns under denaturing conditions (6-8M urea or 6M guanidine-HCl) followed by on-column refolding.

  • Detergent solubilization: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) to maintain protein solubility.

  • Size-Exclusion Chromatography: Apply as a polishing step to separate monomeric from aggregated forms and remove remaining impurities.

  • Ion Exchange Chromatography: Particularly useful for removing nucleic acid contaminants that often co-purify with positively charged mitochondrial proteins.

Purity assessment should be performed using SDS-PAGE and Western blotting with anti-His antibodies, with expected purity greater than 90% . During reconstitution, the protein should be diluted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added as a stabilizer for long-term storage at -20°C/-80°C .

  • How does ND3 gene polymorphism affect protein function in sea urchin populations?

ND3 polymorphism in sea urchin populations can have significant functional implications for protein function and mitochondrial activity. Research on related sea urchin species has revealed:

Methodologically, researchers can study these polymorphisms through:

  • PCR amplification of mitochondrial genes from different populations

  • Sequencing and bioinformatic analysis to identify variants

  • Expression of variant proteins to assess functional differences

  • Biochemical assays to measure electron transport efficiency

Advanced Research Questions

  • How can CRISPR/Cas9 genome editing be applied to study ND3 function in S. purpuratus?

CRISPR/Cas9 has been successfully applied in sea urchin research and can be adapted to study mitochondrial genes like ND3, though with additional considerations due to the mitochondrial location. A methodological approach would include:

  • gRNA design: Design multiple gRNAs targeting the ND3 gene sequence. In S. purpuratus, CRISPR/Cas9 targeting has shown high efficiency (60-80% of injected embryos) with 67-100% of sequenced clones containing indels at target sites when multiple gRNAs are used .

  • Delivery method: For mitochondrial targeting, specialized approaches are needed:

    • Mitochondria-targeted Cas9 (mtCas9) with mitochondrial localization sequences

    • Delivery of Cas9-gRNA ribonucleoprotein complexes to eggs via microinjection, a technique well-established in sea urchin embryology

  • Validation: Validation of editing can be performed using:

    • PCR amplification and sequencing of the target region

    • Quantitative assessment of mutated vs. wild-type mtDNA copies

    • Functional assays of complex I activity

  • Phenotypic analysis: In sea urchins, CRISPR-based knockouts of other genes have produced highly penetrant phenotypes (>95% in injected embryos) , suggesting this could be effective for studying ND3 function.

Challenges specific to mitochondrial genome editing include:

  • What role does the conserved Cys39 residue play in S. purpuratus ND3, and how can it be studied?

The Cys39 residue in ND3 has been identified as a critical element in complex I function, particularly in the active/deactive transition. Recent research has challenged previous assumptions about this process:

  • Functional significance: Contrary to previous beliefs, studies have shown significant Cys39 exposure during NADH/CoQ oxidoreductase activity, not just in the deactive state .

  • Redox sensitivity: Alkylation of Cys39 during active respiration does not affect complex I activity, but alkylation of the inactive complex irreversibly blocks reactivation .

To study this in S. purpuratus ND3, researchers can employ:

  • Site-directed mutagenesis: Create recombinant ND3 variants with Cys39 replaced by serine or alanine.

  • Isotopic labeling and mass spectrometry: This approach can quantify Cys39 exposure under different conditions by measuring accessibility to labeling reagents .

  • Functional assays:

    • Measure NADH/CoQ oxidoreductase activity of complex I with wild-type vs. mutant ND3

    • Assess sensitivity to redox changes

    • Test response to ischemia-reperfusion conditions

  • Structural analysis: Use techniques like cryo-EM to visualize conformational changes associated with Cys39 exposure.

This research has significant implications for understanding the mechanistic details of complex I function in marine invertebrates and its evolutionary conservation.

  • How do different expression systems affect post-translational modifications of recombinant S. purpuratus ND3?

Post-translational modifications (PTMs) of recombinant proteins are highly dependent on the expression system used. For S. purpuratus ND3, different expression systems offer various advantages:

  • Bacterial expression (E. coli):

    • Lacks most eukaryotic PTM machinery

    • Results in non-glycosylated protein

    • May require refolding from inclusion bodies

    • Offers high yield but potentially compromised function

  • Insect cell expression systems:

    • Provide glycosylation and other eukaryotic PTMs

    • Have been successfully used for sea urchin SpTrf proteins, yielding stable, glycosylated products

    • Results show that insect cell-expressed recombinant proteins are larger than expected due to N-linked glycosylation

    • Functional studies showed that glycosylated recombinant proteins maintain biological activity when compared to non-glycosylated versions

  • Yeast expression:

    • Offers intermediate complexity of PTMs

    • Can produce properly folded membrane proteins

    • Lower cost than mammalian systems

Experimental data from studies with recombinant SpTrf proteins demonstrated that proteins expressed in insect cells:

  • Were more stable compared to non-glycosylated bacterial versions

  • Maintained functional activity in binding assays

  • Some dimerized over time without loss of function

Expression SystemGlycosylationProtein StabilityFunctional ActivityYield
E. coliNoneLowerVariableHigh
Insect cellsYes (N-linked)HigherPreservedMedium
YeastYes (modified)IntermediateGoodMedium
  • What methodologies can be used to study ND3's role in Complex I assembly in sea urchin mitochondria?

Studying the role of ND3 in Complex I assembly in sea urchins requires specialized techniques to address the challenges of working with membrane protein complexes. A comprehensive methodological approach includes:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

    • Allows visualization of intact respiratory complexes

    • Can identify assembly intermediates when ND3 is absent or mutated

    • Different detergents (digitonin, DDM) can be used to maintain complex integrity

  • Pulse-chase labeling:

    • Track the incorporation of labeled ND3 into complex I

    • Monitor assembly kinetics with and without inhibitors

  • Cryo-electron microscopy:

    • Determine structural details of complex I with wild-type vs. mutant ND3

    • Identify interaction interfaces and structural changes

  • Immunoprecipitation with recombinant tagged-ND3:

    • Identify protein-protein interactions during assembly

    • Determine temporal sequence of assembly steps

  • CRISPR/Cas9-mediated depletion:

    • Generate sea urchin cells with reduced ND3 levels

    • Monitor effects on complex I assembly and function

  • Cellular imaging:

    • Fluorescently tag ND3 to monitor its localization during mitochondrial biogenesis

    • Use techniques similar to those applied in sea urchin spine cellular studies

These approaches can reveal how ND3 contributes to the assembly and stability of complex I in sea urchin mitochondria, which may differ from the well-studied mammalian systems.

  • How can recombinant S. purpuratus ND3 be used to investigate mitochondrial disease mechanisms?

Recombinant S. purpuratus ND3 can serve as a valuable tool for investigating mitochondrial disease mechanisms, particularly those involving complex I dysfunction. Methodological approaches include:

  • Comparative functional studies:

    • Express wild-type S. purpuratus ND3 alongside human disease-associated variants

    • Compare biochemical properties and activity

    • Use sea urchin ND3 as an evolutionary reference point

  • Disease-associated mutation modeling:

    • Introduce mutations in recombinant S. purpuratus ND3 that correspond to human disease mutations

    • Assess effects on protein folding, stability, and function

    • Human MT-ND3 is associated with mitochondrial complex I deficiency and Leigh syndrome

  • Complex I reconstitution experiments:

    • Use purified recombinant ND3 to reconstitute complex I in vitro

    • Compare activity with human vs. sea urchin components

    • Identify species-specific differences in function

  • Redox sensitivity analysis:

    • Study how the Cys39 residue in recombinant ND3 responds to oxidative stress

    • Compare with human ND3 responses

    • Investigate potential protective mechanisms in sea urchins

  • Drug screening platforms:

    • Use reconstituted complexes containing recombinant ND3 to screen for compounds that rescue disease-associated phenotypes

    • Identify conserved mechanisms that could be therapeutic targets

Sea urchins are particularly valuable model systems as they share key features of mitochondrial function with vertebrates while offering experimental advantages such as external fertilization and transparent embryonic development, allowing for real-time observation of mitochondrial dynamics.

  • What is known about the evolutionary conservation of ND3 across echinoderm species, and how does S. purpuratus ND3 compare?

ND3 shows interesting patterns of evolutionary conservation across echinoderm species, revealing both highly conserved functional domains and species-specific adaptations:

  • Conservation patterns:

    • Core functional domains involved in electron transport are highly conserved

    • The Cys39 residue, critical for the active/deactive transition, is conserved in most species

    • Mitochondrial genome studies across sea urchin species show that protein-coding genes like ND3 tend to have conserved start and stop codons, with ND3 predominantly using TAG as a stop codon

  • Polymorphism distribution:

    • Studies of mitochondrial DNA in sea urchins have identified significant genetic subdivision among geographic locations

    • In S. purpuratus, population differentiation (mean FST = 0.033 among adults) suggests local adaptation of mitochondrial genes

    • Some echinoderms show trans-species polymorphism in mitochondrial genes, indicating selection pressures that maintain variation across species boundaries

  • Comparative analysis:

    • Complete mitochondrial genome comparisons between different-colored spine morphs of Tripneustes gratilla showed 98.91% similarity , suggesting conservation of mitochondrial genes despite phenotypic differences

    • Whole mitochondrial genome phylogenetic analysis can effectively differentiate between closely related sea urchin species

  • Methodological approaches:

    • PCR amplification using primers designed from conserved regions

    • Sequence alignment and phylogenetic analysis

    • Analysis of selection pressures using dN/dS ratios

    • Structural modeling to identify functionally important residues

Research methodologies for studying ND3 evolution include mitochondrial DNA extraction from spines (a non-destructive method), PCR amplification with primers designed for conserved regions, and shotgun sequencing on instruments like Ion PGM .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.