Recombinant Strongylocentrotus purpuratus NADH-ubiquinone oxidoreductase chain 6 (ND6)

Shipped with Ice Packs
In Stock

Description

Genetic Polymorphism and Isoforms

Two distinct ND6 variants exist in camarodont sea urchins due to a 488A>G substitution :

VariantLength (AA)Termination CodonC-terminal ExtensionFunctional Impact
S162TAGNoneStandard complex I assembly
L165TGG (Trp)Trp-Leu-TrpAlters quinone binding dynamics

This polymorphism arises from overlapping transcription of ND5 and ND6 genes on opposite mitochondrial DNA strands. The L variant’s elongated C-terminus modifies interaction with mtDBP, a transcription factor regulating mitochondrial replication .

Functional Role in Electron Transport Chain

ND6 is indispensable for Complex I activity:

  • Mechanism: Facilitates quinone reduction to quinol while pumping protons across the mitochondrial inner membrane .

  • Pathogenic Mutations: Single amino acid substitutions in ND6 disrupt quinone binding, leading to impaired ATP synthesis and metabolic disorders .

  • Structural Stability: The Trp-Leu-Trp extension in the L variant enhances conformational flexibility under oxidative stress .

Recombinant Production and Applications

The insect cell-expressed recombinant ND6 demonstrates:

  • Glycosylation: Post-translational modifications confirmed via SDS-PAGE and mass spectrometry .

  • Biochemical Assays: Used to study proton-pumping efficiency using fluorescence quenching methods .

  • Comparative Studies: Serves as a model for human mitochondrial diseases linked to Complex I dysfunction .

Research Challenges and Future Directions

  • Functional Heterogeneity: The biological significance of L/S polymorphism remains unresolved, though hypothesized to confer adaptive advantages in fluctuating environments .

  • Technical Limitations: Recombinant ND6 requires co-expression with other Complex I subunits for full activity, complicating in vitro studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol uses a final glycerol concentration of 50%, but customers can adjust this based on their specific needs.
Shelf Life
The shelf life of this product depends on several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We strive to incorporate the tag type you specify during production. If you have a specific tag preference, please inform us and we will prioritize its implementation.
Synonyms
ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Strongylocentrotus purpuratus (Purple sea urchin)
Target Names
ND6
Target Protein Sequence
MVVYVTLIVMLFGSTLVFYSLSPYYSALGLVVFSVPGSFVLSFLGSSFVPIVLFLVYIGG MLVVFPYSSAISPERFPSVNNLGEVVGLVFLFSSWVFMSFDNFQDLKNIFHCFVSGESLV GSNTFYNSGGVLVILGVFVLLVALVGALIISRGIESTIIRAIWLW
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) is believed to be essential for catalytic activity. Complex I plays a critical role in transferring electrons from NADH to the respiratory chain. It is believed that the enzyme's immediate electron acceptor is ubiquinone.
Database Links

KEGG: spu:2652726

Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 6 (ND6) and what is its function in mitochondria?

The protein functions primarily in the electron transport chain, where it participates in the transfer of electrons from NADH to ubiquinone, coupled with proton pumping across the inner mitochondrial membrane. This process is fundamental to cellular energy production through oxidative phosphorylation. Studies on ND6 mutations have demonstrated that alterations in this protein can negatively impact Complex I stability and activity, subsequently affecting the entire mitochondrial respiratory chain maintenance.

How is Recombinant Strongylocentrotus purpuratus ND6 different from other species' ND6 proteins?

Recombinant Strongylocentrotus purpuratus ND6 represents a specific variant derived from the purple sea urchin species. While the core functional domains of ND6 are generally conserved across species due to its essential role in respiratory metabolism, comparative genomic analyses reveal species-specific variations that reflect evolutionary adaptations to different environmental conditions and metabolic requirements.

Unlike mammalian ND6 variants that have been extensively studied in the context of mitochondrial diseases, the sea urchin variant offers unique research opportunities for comparative functional studies. The Strongylocentrotus purpuratus ND6 contains specific sequence characteristics that may contribute to its adaptation to marine environments, potentially including differences in temperature sensitivity, oxidative stress response, and protein-protein interactions within Complex I.

Similar to studies conducted on adaptive evolution of ND6 in horses living at high altitudes, researchers can investigate whether the sea urchin ND6 displays unique adaptations related to marine environmental pressures. These comparative studies would require advanced phylogenetic analysis methods including directional and non-directional selection tests to identify adaptively evolved sites.

What are the optimal storage conditions for Recombinant Strongylocentrotus purpuratus ND6?

For optimal preservation of Recombinant Strongylocentrotus purpuratus ND6 activity and stability, the following storage conditions are recommended:

  • Long-term storage: Maintain at -20°C or preferably -80°C in aliquots to minimize freeze-thaw cycles.

  • Working aliquots: Store at 4°C for up to one week to maintain protein integrity for ongoing experiments.

  • Formulation: The protein is typically supplied in liquid form containing glycerol, which acts as a cryoprotectant.

  • Repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of functional activity.

When designing experiments, researchers should account for potential activity loss during storage by including appropriate controls and calibration standards. For extended research projects, it is advisable to prepare multiple small aliquots during initial reconstitution to minimize repeated freeze-thaw cycles of the stock solution.

What is the role of ND6 in Complex I assembly and stability?

ND6 plays a critical role in the assembly and stability of Complex I, which is the most elaborate of all OXPHOS complexes with 45 subunits. Recent research has identified ND6 as a key component at the junction between the P and Q modules of Complex I, where it contributes significantly to the structural integrity of the complex.

Studies on mutated forms of ND6 have provided valuable insights into its importance. For instance, truncated ND6 (ΔND6) lacking the C-terminal region has been shown to negatively impact Complex I stability and activity. Molecular dynamics simulations have revealed that the loss of alpha helices in the C-terminal region of ND6 leads to conformational rearrangements that destabilize the entire complex.

The assembly of Complex I follows a model based on the production and assembly of modules in a series of parallel, coordinated steps. ND6 appears to play a crucial role in this process, particularly in the formation of the E-channel, which is essential for electron flow within Complex I. Disruptions to ND6 structure or expression can therefore have cascading effects on the entire respiratory chain.

What molecular dynamics simulation approaches can be used to study conformational changes in mutated ND6 proteins?

Molecular dynamics simulation (MDS) provides powerful tools for examining conformational changes in mutated ND6 proteins, offering insights that complement experimental data. Based on recent research on ΔND6, several key approaches are particularly valuable:

  • Residual Mean Square Fluctuation (RMSF) Analysis: This technique measures atomic positional fluctuations during simulation, identifying regions of increased mobility in the protein structure. In ΔND6 studies, RMSF analysis revealed elevated movement in the N-terminal region, which is typically conformationally stable in the wild-type protein. This finding suggested spatial rearrangement or partial unfolding compared to the wild-type.

  • Solvent Accessible Surface Area (SASA) Analysis: This approach quantifies the protein surface area accessible to solvent molecules, providing insights into conformational compactness. Analysis of ΔND6 showed the truncated form adopts a more compact conformation compared to wild-type ND6, with low fluctuations in solvent-accessible area indicating conformational rearrangements rather than unfolding.

  • Native Contact Preservation Assessment: This method compares the preservation of native contacts (defined as Cα atoms less than 7 Å apart) between the original and simulated structures. In ΔND6 simulations, approximately one-quarter of the original contacts were lost compared to wild-type ND6, though the retained fraction remained stable in later simulation stages.

For researchers studying Recombinant Strongylocentrotus purpuratus ND6, these approaches can be implemented using software packages such as GROMACS, AMBER, or NAMD. The simulation protocol should include:

  • System preparation with appropriate force fields optimized for membrane proteins

  • Solvation in explicit water models with physiological ion concentrations

  • Energy minimization followed by equilibration phases

  • Production runs of sufficient duration (typically >100 ns) to capture relevant conformational changes

  • Comparative analysis between wild-type and mutant forms using the metrics described above

These simulations can provide mechanistic insights into how specific mutations might affect ND6 structure and function, guiding subsequent experimental investigations and potentially informing therapeutic strategies.

How does ND6 contribute to the E-channel formation in Complex I, and what experimental methods can be used to investigate this?

The E-channel in Complex I represents a critical pathway for electron transfer within the respiratory complex. Recent research, particularly studies by Laube et al. (2022) on Chaetomium thermophilum, has demonstrated that ND6 plays a pivotal role in establishing this channel. The specific contribution of ND6 to E-channel formation involves its strategic positioning at the junction between the P and Q modules of Complex I, where it facilitates electron flow through the complex.

Experimental methods to investigate ND6's role in E-channel formation include:

  • Site-Directed Mutagenesis: Targeted mutations of conserved residues in ND6 can help identify amino acids critical for E-channel formation. Researchers can use CRISPR-Cas9 technology for mitochondrial DNA editing or recombinant expression systems to generate mutant variants.

  • Cryo-Electron Microscopy (Cryo-EM): High-resolution structural analysis of Complex I with wild-type versus mutated ND6 can reveal conformational changes affecting the E-channel. This technique allows visualization of subtle structural alterations without crystallization requirements.

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: This method can track electron transfer through the E-channel by monitoring redox-active centers in Complex I. Spin-labeling specific residues in ND6 can provide insights into local conformational changes affecting channel function.

  • Potentiometric Titrations: These experiments can measure the redox potential changes associated with electron transfer through the E-channel, helping to quantify the functional impact of ND6 mutations.

  • Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can detect changes in protein dynamics and solvent accessibility, potentially revealing how ND6 mutations affect E-channel conformation and stability.

For the Recombinant Strongylocentrotus purpuratus ND6, comparative studies with better-characterized mammalian systems would be particularly valuable. Sequence alignment and homology modeling can identify conserved regions likely involved in E-channel formation, guiding targeted experimental investigations.

What are the implications of ND6 mutations for understanding mitochondrial diseases and cancer development?

ND6 mutations have significant implications for both mitochondrial diseases and cancer development, providing valuable insights into fundamental mechanisms of pathogenesis. Recent research on ND6 mutations offers several important perspectives:

  • Cancer Development: The study of a novel ND6 mutation in hepatocellular carcinoma (HCC) revealed that a frameshift mutation resulting in a truncated ND6 protein (ΔND6) negatively impacted Complex I stability and activity. This finding suggests that ND6 mutations may contribute to the metabolic reprogramming characteristic of cancer cells, potentially promoting tumor development by altering mitochondrial function. The observation that ND6 mutations can be heteroplasmic (present in a subset of mtDNA molecules) allows for gradual adaptation of cellular metabolism, potentially supporting tumor progression.

  • Mitochondrial Diseases: While the search results don't specifically address classical mitochondrial diseases, the fundamental role of ND6 in Complex I assembly and function implies that mutations in this gene could contribute to mitochondrial disorders characterized by Complex I deficiency. The mechanistic insights from cancer studies, particularly regarding how structural alterations in ND6 affect Complex I stability, likely extend to congenital mitochondrial diseases.

  • Therapeutic Targeting: The critical role of ND6 in maintaining respiratory complex integrity suggests it could be exploited as a therapeutic target. As noted in the HCC study, "The determining role of ND6 can be exploited in the future by identifying new therapies targeting ND6 to perturb OXPHOS and eventually interfere with tumor development."

For researchers working with Recombinant Strongylocentrotus purpuratus ND6, comparative studies with human ND6 could provide evolutionary insights into conserved functional domains that, when mutated, lead to disease. Additionally, the sea urchin model offers opportunities to study how ND6 function might adapt to different physiological conditions, potentially informing our understanding of how cells respond to mitochondrial stress in disease states.

Methodologically, researchers investigating disease-associated ND6 mutations should consider integrating:

  • Next-generation sequencing of mitochondrial DNA to identify novel mutations

  • Functional assays measuring Complex I activity and assembly

  • Molecular dynamics simulations to predict structural impacts

  • Cellular models expressing mutant ND6 to assess metabolic consequences

What expression systems are optimal for producing functional Recombinant Strongylocentrotus purpuratus ND6?

Producing functional Recombinant Strongylocentrotus purpuratus ND6 presents unique challenges due to its highly hydrophobic nature and mitochondrial origin. Based on current practices in recombinant protein production, several expression systems can be considered:

  • E. coli Expression System: While commonly used for recombinant protein production, E. coli systems may struggle with proper folding of mitochondrial membrane proteins. If using this system, consider:

    • Using specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression

    • Expressing as a fusion with solubility-enhancing tags (MBP, SUMO)

    • Optimizing codon usage for bacterial expression

    • Including chaperones to assist proper folding

  • Yeast Expression Systems: Saccharomyces cerevisiae or Pichia pastoris offer eukaryotic processing capabilities:

    • Provide a more suitable environment for mitochondrial protein folding

    • Allow for post-translational modifications

    • Can be scaled for larger production volumes

    • Offer compatibility with mitochondrial targeting sequences

  • Baculovirus-Insect Cell System: Provides advanced eukaryotic processing:

    • High expression levels for complex proteins

    • Proper folding of membrane proteins

    • Compatible with lipid environments similar to native mitochondria

    • Amenable to structural studies of membrane proteins

  • Mammalian Cell Expression: Offers the most native-like environment:

    • Most suitable for functional studies requiring proper folding and interactions

    • Allows assessment of integration into mammalian Complex I

    • Supports studies of protein-protein interactions with other Complex I subunits

    • Can be used for localization studies with fluorescent tags

Expression SystemAdvantagesDisadvantagesOptimal Applications
E. coliCost-effective, high yield, rapidChallenging for membrane proteins, lack of PTMsInitial characterization, antibody production
YeastEukaryotic processing, scalableLonger production time, glycosylation differencesStructural studies, protein interaction assays
Baculovirus-Insect CellHigh expression of complex proteinsTechnical complexity, costFunctional assays, structural biology
Mammalian CellMost native-like environmentHighest cost, lower yieldsComplex assembly studies, functional assays

For optimal purification of functional ND6, detergent screening is crucial, with mild detergents like digitonin or DDM often most suitable for maintaining native structure of membrane proteins. Additionally, including stabilizing lipids during purification can help maintain protein integrity.

How can researchers effectively analyze ND6 mutations and their functional consequences?

Analyzing ND6 mutations and their functional consequences requires a comprehensive approach that integrates genomic, biochemical, and computational methods. Based on recent research methodologies, the following multi-step approach is recommended:

  • Mutation Identification and Characterization:

    • Next-generation sequencing of mitochondrial DNA with high read depth to detect heteroplasmic mutations

    • PCR-RFLP or digital droplet PCR to quantify heteroplasmy levels

    • Consensus sequence derivation using bioinformatics tools like bcftools

    • Translation and analysis of altered reading frames using Expasy or similar tools

  • Protein Expression Analysis:

    • Western blotting with domain-specific antibodies (N-terminal and C-terminal) to detect truncated forms

    • BN-PAGE (Blue Native Polyacrylamide Gel Electrophoresis) to assess Complex I assembly

    • Immunoprecipitation to study interactions with other Complex I subunits

  • Functional Assessment:

    • Spectrophotometric assays measuring NADH:ubiquinone oxidoreductase activity

    • Oxygen consumption measurements in isolated mitochondria

    • ATP production assays to assess impact on oxidative phosphorylation

    • Membrane potential measurements using fluorescent dyes like TMRM or JC-1

  • Structural Analysis:

    • Molecular dynamics simulations to predict conformational changes

    • Analysis metrics including RMSF, SASA, and native contact preservation

    • Comparative modeling based on known Complex I structures

  • Evolutionary Analysis:

    • Site-specific likelihood tests to identify potential selected sites

    • Relative ratio tests to distinguish directional and non-directional selection

    • Statistical validation using G test and Fisher exact test

For Recombinant Strongylocentrotus purpuratus ND6 specifically, researchers should establish baseline functional parameters before introducing mutations. Comparing sea urchin ND6 with better-characterized mammalian variants can provide valuable context for interpreting mutation effects.

When designing mutation studies, both naturally occurring variants and rationally designed mutations targeting conserved residues should be considered. The use of heterologous expression systems can facilitate rapid screening of multiple mutations, while validation in more native-like contexts provides physiological relevance.

What are the key considerations for designing experiments to study ND6's role in Complex I assembly?

Designing experiments to study the role of Recombinant Strongylocentrotus purpuratus ND6 in Complex I assembly requires careful consideration of multiple factors to ensure valid and reproducible results. Based on current research methodologies, here are key considerations:

  • Model System Selection:

    • Homologous system: Using sea urchin mitochondria provides the most relevant context but presents technical challenges

    • Heterologous systems: Mammalian cell lines depleted of endogenous ND6 can be complemented with sea urchin ND6

    • Hybrid complexes: Assessing incorporation of recombinant ND6 into partial assemblies of Complex I

  • Assembly Intermediate Characterization:

    • BN-PAGE with antibodies against subunits from different modules can track assembly progression

    • Pulse-chase experiments with radioactively labeled mitochondrial proteins can monitor temporal assembly dynamics

    • Density gradient centrifugation can separate assembly intermediates for proteomic analysis

  • Interaction Partner Identification:

    • Proximity labeling approaches (BioID, APEX) can identify proteins in close proximity to ND6 during assembly

    • Cross-linking mass spectrometry can capture transient interactions during the assembly process

    • Co-immunoprecipitation with tagged ND6 variants can identify stable interaction partners

  • Mutation Impact Assessment:

    • Systematic mutation of conserved residues can identify regions critical for assembly

    • Domain swapping between species can determine species-specific assembly requirements

    • Deletion constructs can establish minimal regions necessary for Complex I incorporation

  • Temporal Resolution Approaches:

    • Inducible expression systems allow controlled initiation of assembly processes

    • Time-resolved proteomics can track assembly kinetics

    • Correlation of assembly stages with functional metrics provides insight into structure-function relationships

Experimental ApproachInformation ProvidedTechnical ComplexityEquipment Requirements
BN-PAGE & Western BlottingAssembly intermediate formation, complex stabilityModerateGel electrophoresis, antibodies
Pulse-Chase LabelingAssembly kinetics, temporal sequenceHighRadioisotope handling facilities
Proximity LabelingSpatial organization, transient interactionsHighMass spectrometry
Inducible ExpressionAssembly initiation, rate-limiting stepsModerateControlled expression systems
Electron MicroscopyStructural organization of intermediatesVery HighElectron microscope, sample preparation

Given the complex coordination required for Complex I assembly involving 45 subunits, researchers should design experiments that can distinguish between direct effects of ND6 alterations and downstream consequences. Control experiments should include known assembly factors as positive controls and unrelated mitochondrial proteins as negative controls.

How might comparative studies of ND6 across evolutionary diverse species inform therapeutic strategies?

Comparative studies of ND6 across evolutionarily diverse species offer promising avenues for developing novel therapeutic strategies targeting mitochondrial dysfunction. Such cross-species analyses provide unique insights that cannot be obtained from studying a single organism:

  • Identification of Functionally Critical Domains: Regions of ND6 that are highly conserved across diverse species, from sea urchins to mammals, likely represent functionally indispensable domains. These conserved elements make ideal targets for therapeutic interventions, as they suggest structural or functional constraints that limit variation.

  • Adaptation-Driven Variations: Studies of ND6 adaptations in species living in extreme environments, such as high-altitude horses or deep-sea organisms like Strongylocentrotus purpuratus, can reveal natural solutions to environmental stressors. These adaptations might provide templates for therapies addressing mitochondrial stress in disease states.

  • Tolerance to Mutations: Comparative analysis can identify regions of ND6 that tolerate variation across species but are invariant in disease-associated mutations. Such regions may represent "druggable" sites where therapeutic modulation could occur without catastrophic functional consequences.

  • Alternative Functional Mechanisms: Some species may have evolved alternative mechanisms to accomplish the same functional outcomes despite variations in ND6 structure. These alternative pathways could inspire bypass strategies for treating conditions associated with ND6 dysfunction.

Methodologically, evolutionary studies should employ:

  • Phylogenetic analysis using maximum likelihood methods

  • Site-specific evolutionary rate calculation

  • Positive selection detection using methods like PAML's site-specific likelihood tests

  • Structural mapping of evolutionary constraints onto protein models

For Recombinant Strongylocentrotus purpuratus ND6 specifically, its marine origin makes it valuable for understanding adaptations to oxidative stress, temperature variations, and metabolic flexibility. These adaptations could inform therapeutic approaches for conditions characterized by these stressors, such as ischemia-reperfusion injury or neurodegenerative diseases with mitochondrial involvement.

Future therapeutic strategies that could emerge from such comparative studies include:

  • Small molecules targeting evolutionarily conserved pockets in ND6

  • Peptide-based therapies mimicking species-specific adaptations

  • Gene therapy approaches informed by naturally occurring compensatory mechanisms

  • Metabolic modifications based on species-specific energy production strategies

What are the emerging technologies that could advance our understanding of ND6 structure and function?

Several emerging technologies hold significant promise for advancing our understanding of Recombinant Strongylocentrotus purpuratus ND6 structure and function:

  • Cryo-Electron Microscopy (Cryo-EM) Advances:

    • Single-particle analysis at near-atomic resolution can reveal detailed structures of ND6 within the Complex I assembly

    • Time-resolved cryo-EM can potentially capture different conformational states during electron transport

    • Correlative light and electron microscopy (CLEM) can connect structural insights with functional observations in situ

  • AI-Enhanced Structural Prediction:

    • AlphaFold2 and RoseTTAFold can predict structures of ND6 variants with increasing accuracy

    • Machine learning approaches can model protein-protein interactions between ND6 and other Complex I subunits

    • Neural networks can predict functional consequences of mutations based on structural perturbations

  • Advanced Mitochondrial Genome Editing:

    • Mitochondrially targeted CRISPR systems allow precise editing of mtDNA

    • Base editors and prime editors enable specific nucleotide modifications without double-strand breaks

    • Transcription activator-like effector nucleases (TALENs) provide alternative approaches for mitochondrial genome manipulation

  • Single-Molecule Techniques:

    • FRET (Förster Resonance Energy Transfer) can measure conformational changes in ND6 during function

    • Nanopore recording can potentially track ion movements associated with proton pumping

    • Optical tweezers can measure forces associated with conformational changes

  • Spatially Resolved Multi-omics:

    • Spatial transcriptomics can map expression patterns in tissues with mitochondrial dysfunction

    • Proximity proteomics can identify the interactome of ND6 in different cellular contexts

    • Metabolic flux analysis with stable isotopes can track alterations in mitochondrial function

  • Organoid and Microphysiological Systems:

    • Tissue-specific organoids can model ND6 dysfunction in relevant physiological contexts

    • Organ-on-chip platforms can assess systemic consequences of mitochondrial alterations

    • Multi-cellular systems can examine tissue-specific responses to mitochondrial stress

These technologies, particularly when used in combination, have the potential to transform our understanding of how ND6 contributes to Complex I function and mitochondrial metabolism. For researchers working with Recombinant Strongylocentrotus purpuratus ND6, these approaches offer opportunities to connect evolutionary adaptations with structural and functional characteristics unique to this species.

The integration of computational approaches with experimental validation will be particularly valuable, allowing researchers to generate and test hypotheses about ND6 function more efficiently. As these technologies continue to evolve, our understanding of the fundamental roles of ND6 in mitochondrial function and disease will similarly advance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.