Recombinant Strongylocentrotus purpuratus Protein SPEC3 (SPEC3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
SPEC3; Protein SPEC3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Strongylocentrotus purpuratus (Purple sea urchin)
Target Names
SPEC3
Target Protein Sequence
MAQVAPTGAPTDAPPAYPPPPQQAPPPQQPGYGQPQLGYGQPPPQLGYGQPPPQLGYGYP PPPQNNNMMMNNTVVVTAPAPAPANNVVIINQKKDNCCRQAIPAHHIAAAILCLIFNIFF PGIGTIIAGFAVFCCGNPGADGGSKVGTMCINFWIGLLQIGTVWFFFLGWIWSIMWGAAF IGMSADYHSGGDTTIVATGGGGTTVINN
Uniprot No.

Target Background

Protein Families
SPEC3 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cell projection, cilium. Note=In cilia and Golgi complexes.

Q&A

What is SPEC3 and what is its role in Strongylocentrotus purpuratus?

SPEC3 is a protein found in the sea urchin Strongylocentrotus purpuratus, where its expression is associated with ectodermal ciliogenesis. The protein plays a significant role in the development and function of cilia in the ectodermal cells of sea urchin embryos. Studies have demonstrated that SPEC3 expression coincides with the formation of cilia in the ectoderm, suggesting it has a specific function in this developmental process .

SPEC3 belongs to a group of proteins that are developmentally regulated during sea urchin embryogenesis. Its specific function appears to be related to ciliary structure or function, as evidenced by its localization to cilia and persistence in the ciliary axoneme even after membrane extraction. This suggests that SPEC3 may be an integral component of the ciliary architecture or may play a role in ciliary movement or sensory functions .

Research on SPEC3 contributes to our broader understanding of ciliogenesis, a fundamental developmental process that is conserved across many species. Abnormalities in cilia development and function are associated with various diseases, making SPEC3 and similar proteins important subjects for comparative studies in developmental and cellular biology.

Where is SPEC3 protein localized in sea urchin cells?

Immunofluorescent staining using antisera raised against the amino terminus of SPEC3 has revealed that the protein is primarily localized to cilia and an apical structure at the base of the cilium of each ectodermal cell. These structures stain intensely in gastrula and later stage embryos of S. purpuratus .

Additionally, SPEC3 shows localization to the Golgi complex. This was demonstrated when microtubule-depolymerizing agents dispersed the concentrated spot of apical staining, suggesting that SPEC3 is associated with the Golgi complex. Immunogold electron microscopy has confirmed the presence of SPEC3 on both cilia and in the Golgi complex .

In hatching blastula embryos, when SPEC3 transcripts are most prevalent, the protein shows a diffuse punctate staining pattern in the ectodermal cytoplasm. This observation suggests that after synthesis, SPEC3 is sequestered in the Golgi complex before appearing on cilia . This sequential localization pattern provides insight into the processing and trafficking of SPEC3 during development, indicating a coordinated pathway for protein deployment during ciliogenesis.

What is the molecular weight of native SPEC3 protein and how does it vary across species?

Interestingly, in a different sea urchin species, Lytechinus pictus, SPEC3 is also concentrated in cilia but migrates with a molecular weight of approximately 23,000 Da . This difference suggests species-specific variations in either the protein structure or its post-translational modifications.

The discrepancy between the predicted molecular weight and the observed size in S. purpuratus suggests that SPEC3 may form stable complexes or undergo significant post-translational modifications. The fact that these aggregates are SDS-resistant indicates very strong protein-protein interactions, which may be functionally significant for the protein's role in ciliary structure or function.

What are the most effective methodologies for studying SPEC3 localization in sea urchin embryos?

Several complementary techniques have proven effective for studying SPEC3 localization in sea urchin embryos. Immunofluorescent staining using antisera raised against the amino terminus of SPEC3 has been successfully used to visualize the protein's distribution in fixed embryos . This approach allows for high-resolution imaging of SPEC3 in relation to cellular structures.

For more precise subcellular localization, immunogold electron microscopy has been employed. This technique confirmed the presence of SPEC3 on cilia and in the Golgi complex with nanometer-scale resolution . The combination of immunofluorescence and immunogold electron microscopy provides complementary data at different resolution scales.

Experimental manipulation with microtubule-depolymerizing agents, followed by immunostaining, has helped elucidate the association of SPEC3 with the Golgi complex . This approach demonstrates how pharmacological interventions can provide insights into protein dynamics and associations. For studying protein trafficking, pulse-chase experiments with metabolic labeling could track the movement of newly synthesized SPEC3 from the Golgi complex to cilia over time.

For live-cell dynamics, researchers might consider using fluorescent protein tags (e.g., GFP-SPEC3 fusion proteins) combined with confocal or light-sheet microscopy. While technically challenging in sea urchin embryos, this approach could provide valuable real-time data on SPEC3 trafficking and localization during development.

How can recombinant SPEC3 be produced for functional studies?

Production of recombinant SPEC3 for functional studies requires careful consideration of expression systems and purification strategies. The following methodological approach is recommended:

Expression System Selection:

Expression SystemAdvantagesDisadvantagesSuitability for SPEC3
E. coliSimple, cost-effective, high yieldLimited post-translational modificationsMay not form proper structure
Yeast (P. pastoris)Some post-translational modificationsModerate complexityBetter than bacterial systems
Insect cells (Sf9)Good eukaryotic modificationsHigher cost, more complexWell-suited for SPEC3
Mammalian cellsMost native-like modificationsHighest cost and complexityBest for preserving native structure

For SPEC3, considering its localization to cilia and Golgi, and its tendency to form SDS-resistant aggregates in S. purpuratus, an insect or mammalian expression system would likely be most appropriate to preserve functional properties.

Recommended Protocol:

  • Gene synthesis or PCR amplification of the SPEC3 coding sequence from S. purpuratus cDNA

  • Cloning into an expression vector with an appropriate affinity tag (e.g., His-tag)

  • Expression in insect cells using a baculovirus expression system

  • Cell lysis under native conditions

  • Affinity chromatography purification

  • Size exclusion chromatography to separate monomeric and aggregated forms

  • Functional verification through binding assays or structural studies

Special consideration should be given to the protein's tendency to form SDS-resistant aggregates, which might affect purification strategies and downstream applications. Optimization of buffer conditions to maintain the protein in its native state will be crucial for functional studies.

What are the approaches for studying the SPEC3 protein structure and its relationship to function?

Understanding the structure-function relationship of SPEC3 requires a multi-faceted approach combining various structural biology techniques:

These structural studies should be complemented by functional assays to correlate structural features with specific activities. For example, site-directed mutagenesis of predicted functional domains followed by localization studies in sea urchin embryos could link structure to function in vivo.

How can the SDS-resistant aggregates of SPEC3 be analyzed and what might they reveal about protein function?

The unusual SDS-resistant aggregates formed by SPEC3 in S. purpuratus present both experimental challenges and potential insights into protein function. The following analytical approaches are recommended:

Characterization Methods:

  • Blue Native PAGE: This technique can separate protein complexes in their native state, preserving physiologically relevant interactions.

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS): This combination can determine the absolute molecular weight of SPEC3 complexes and assess their homogeneity.

  • Analytical Ultracentrifugation: Sedimentation velocity and equilibrium experiments can provide information about the size, shape, and heterogeneity of SPEC3 aggregates.

  • Negative Staining Electron Microscopy: This technique can visualize the morphology of SPEC3 aggregates and potentially reveal their organization.

  • Crosslinking Mass Spectrometry: Chemical crosslinking followed by mass spectrometry analysis can identify interaction interfaces within the SPEC3 aggregates.

Research Questions to Address:

  • Are the aggregates homogeneous or heterogeneous in composition?

  • Does SPEC3 form ordered oligomers or more irregular aggregates?

  • Are the aggregates functionally relevant or a consequence of experimental conditions?

  • Do the aggregates contain other proteins besides SPEC3?

  • How does the aggregation state affect SPEC3's ability to associate with ciliary structures?

Understanding these aggregates could provide insights into how SPEC3 functions in the ciliary axoneme. The fact that SPEC3 remains associated with the axoneme after membrane extraction suggests that these aggregates might play a structural role in cilia . Comparison with the non-aggregating form in L. pictus could provide particularly valuable insights into the functional significance of aggregation.

How can gene editing techniques be optimized for studying SPEC3 function in sea urchin embryos?

Gene editing in sea urchin embryos presents unique challenges but offers powerful approaches for studying SPEC3 function. The following methodological considerations are important:

  • CRISPR-Cas9 Delivery: Microinjection into fertilized eggs is the most effective method. For optimal results:

    • Use purified Cas9 protein complexed with guide RNA rather than plasmid expression

    • Inject at the one-cell stage before the first cleavage

    • Include a visual marker (e.g., fluorescent protein) to track successfully injected embryos

  • Guide RNA Design for SPEC3:

    • Target early exons to ensure complete loss of function

    • Verify target site conservation if comparing effects across species

    • Design multiple guide RNAs to increase chances of successful editing

    • Check for off-target effects using sea urchin genome databases

  • Validation Strategies:

    • PCR and sequencing of the target region from individual embryos

    • Western blotting to confirm loss of SPEC3 protein

    • Immunostaining to verify altered localization patterns

    • Functional assays focusing on ciliary development and function

  • Phenotypic Analysis:

    • High-resolution imaging of ciliary structures

    • Video microscopy to assess ciliary motility

    • Behavioral assays to evaluate swimming and feeding capabilities

    • Electron microscopy to examine ultrastructural changes in cilia

  • Controls and Rescue Experiments:

    • Include appropriate controls (uninjected, Cas9 only, non-targeting guide RNA)

    • Perform rescue experiments by co-injecting wild-type SPEC3 mRNA

    • Use domain-specific rescue constructs to identify functional regions

Special consideration should be given to the timing of SPEC3 expression during development to ensure that gene editing disrupts protein function before its critical developmental role. Additionally, mosaic expression in injected embryos may complicate analysis, necessitating careful selection of consistently edited specimens.

What approaches can resolve contradictory data on SPEC3 function across different experimental conditions or sea urchin species?

Resolving contradictory data on SPEC3 function requires systematic investigation of variables that might influence experimental outcomes. The following methodological framework is recommended:

  • Standardize Experimental Protocols:

    • Use consistent developmental staging criteria across species

    • Standardize protein extraction and analysis methods

    • Employ the same fixation and immunostaining protocols

    • Use identical criteria for phenotypic assessment

  • Cross-Species Comparative Studies:

    • Directly compare SPEC3 from S. purpuratus and L. pictus in the same experiments

    • Create chimeric proteins to identify domains responsible for species-specific differences

    • Perform heterologous expression studies (express one species' protein in the other)

    • Sequence analysis to identify key differences that might explain functional variation

  • Control for Environmental Variables:

    • Maintain consistent temperature, pH, and salinity conditions

    • Use embryos from the same breeding season when possible

    • Account for natural genetic variation by using multiple breeding pairs

  • Technical Validation:

    • Employ multiple antibodies targeting different epitopes of SPEC3

    • Use complementary techniques to verify key findings

    • Quantitative analysis with appropriate statistical methods

    • Blind scoring of phenotypes to reduce observer bias

  • Data Integration Framework:

    • Develop a unified model that accommodates apparently contradictory findings

    • Consider developmental timing as a potential explanation for differences

    • Explore the possibility of multiple functions for SPEC3 depending on context

    • Investigate post-translational modifications that might differ across conditions

By systematically addressing these factors, researchers can determine whether contradictory data reflect genuine biological differences or technical artifacts. This comprehensive approach will lead to a more nuanced understanding of SPEC3 function across different contexts.

How does SPEC3 integrate with gene regulatory networks during sea urchin development?

Understanding how SPEC3 integrates with gene regulatory networks (GRNs) during sea urchin development requires examining its regulation and interactions with other developmental pathways. Current research suggests several important connections:

SPEC3 expression is associated with ectodermal ciliogenesis, indicating it is part of the gene regulatory network governing ciliary development in ectodermal cells . This places SPEC3 within the broader context of cell type specification and differentiation in the sea urchin embryo.

While the regulatory factors controlling SPEC3 expression have not been fully characterized, its temporal expression pattern suggests coordination with other ciliogenesis genes. The protein shows a diffuse pattern in the ectodermal cytoplasm at the hatching blastula stage when transcripts are most prevalent, followed by localization to cilia in later stages .

Recent single-cell RNA sequencing studies of S. purpuratus early pluteus larva have identified distinct cell clusters representing cells of various systems, including ectodermal derivatives . These datasets could be leveraged to place SPEC3 within specific gene co-expression modules and identify potential upstream regulators or downstream effectors.

The connection between SPEC3 and the Golgi complex suggests it may be regulated by pathways governing protein trafficking and ciliary assembly. This could include integration with GRNs controlling cytoskeletal organization, as evidenced by the effect of microtubule-depolymerizing agents on SPEC3 localization .

Future research should focus on identifying transcription factors that regulate SPEC3 expression, potentially through promoter analysis and chromatin immunoprecipitation studies. Integration with existing GRN models for sea urchin development would place SPEC3 in the broader context of developmental regulation.

How can SPEC3 research inform our understanding of ciliopathies and related developmental disorders?

Although SPEC3 is a sea urchin protein, its study can provide valuable comparative insights relevant to human ciliopathies for several reasons:

  • Conserved Ciliary Mechanisms: Many fundamental aspects of ciliary structure and function are conserved across species. SPEC3's role in sea urchin cilia may reveal general principles applicable to understanding human ciliary biology .

  • Model for Protein Trafficking: The movement of SPEC3 from the Golgi complex to cilia provides a model system for studying protein trafficking to ciliary compartments . Defects in ciliary protein trafficking underlie many human ciliopathies, making this aspect of SPEC3 biology particularly relevant.

  • Structural Insights: The association of SPEC3 with the ciliary axoneme after membrane extraction suggests a structural role that might be paralleled by certain human ciliary proteins . Understanding how SPEC3 contributes to axonemal structure could inform studies of human axonemal proteins implicated in ciliopathies.

  • Developmental Context: SPEC3's expression during sea urchin embryonic development provides a context for understanding how ciliary proteins are deployed during embryogenesis . This developmental perspective is crucial for understanding the embryonic origins of human ciliopathies.

  • Experimental Advantages: The sea urchin embryo offers experimental advantages for studying ciliogenesis, including external development, optical transparency, and amenability to various molecular manipulations. These features facilitate research that might be challenging in mammalian systems.

Researchers studying SPEC3 should consider systematically comparing its sequence, structure, and function with potential human homologs or functionally similar proteins. Even without direct homology, mechanistic insights from SPEC3 research could suggest new approaches for investigating human ciliary proteins and potentially inform therapeutic strategies for ciliopathies.

How could single-cell RNA sequencing data be leveraged to better understand SPEC3 expression and function?

Single-cell RNA sequencing (scRNA-seq) offers powerful approaches to enhance our understanding of SPEC3 expression and function in sea urchin development. Recent scRNA-seq studies of S. purpuratus have provided unprecedented resolution of cell types and gene expression patterns , which could be leveraged in several ways:

  • Cell Type-Specific Expression: scRNA-seq can precisely identify which cell types express SPEC3 and at what levels, creating a comprehensive map of its expression across all cells in the embryo. This could reveal previously unrecognized SPEC3-expressing populations beyond the known ectodermal cells .

  • Co-expression Analysis: Identification of genes that consistently co-express with SPEC3 across single cells can reveal functional associations and potential regulatory relationships. This approach could identify components of the SPEC3 pathway that might not be detected through traditional methods .

  • Temporal Dynamics: By performing scRNA-seq at multiple developmental timepoints, researchers can track the dynamics of SPEC3 expression with high temporal resolution, potentially identifying transient expression patterns that might be missed by bulk methods.

  • Regulatory Network Inference: Computational analysis of scRNA-seq data can infer gene regulatory networks, potentially identifying transcription factors that regulate SPEC3 and other genes involved in ciliogenesis .

  • Response to Perturbations: Combining scRNA-seq with CRISPR-based perturbations of SPEC3 or related genes could reveal downstream effects on gene expression at single-cell resolution, providing insights into SPEC3 function.

  • Integration with Spatial Data: Combining scRNA-seq with spatial transcriptomics or in situ hybridization could map SPEC3 expression patterns in the context of embryonic anatomy, enhancing our understanding of its spatial regulation.

Application of scRNA-seqExpected Insight for SPEC3 Research
Cell clustering analysisPrecise identification of all SPEC3-expressing cell types
Differential expressionGenes specifically co-expressed with SPEC3
Trajectory analysisDevelopmental progression of SPEC3-expressing cells
Network inferenceRegulatory factors controlling SPEC3 expression
Cross-species comparisonConservation of SPEC3 expression patterns

These approaches would provide a more comprehensive understanding of SPEC3's role in development and potentially reveal new aspects of its function that have not been captured by traditional methods .

What new experimental approaches could address unresolved questions about SPEC3 function?

Several innovative experimental approaches could provide breakthrough insights into SPEC3 function:

  • Proximity Labeling Proteomics: Techniques such as BioID or APEX2 fusion with SPEC3 could identify proteins in close proximity to SPEC3 in living cells. This approach would reveal the protein's interaction partners in different subcellular locations (Golgi vs. cilia) and potentially clarify its function in these compartments.

  • Live Cell Super-Resolution Microscopy: Techniques like STORM or PALM combined with genetically encoded fluorescent tags could track SPEC3 trafficking from the Golgi to cilia with unprecedented spatial and temporal resolution, providing insights into the dynamics of SPEC3 deployment during ciliogenesis.

  • Cryo-Electron Tomography: This technique could visualize SPEC3 in its native context within the ciliary axoneme at near-atomic resolution, potentially revealing its structural role and associations with other axonemal components.

  • In Vitro Reconstitution: Purified recombinant SPEC3 could be used in reconstitution assays with ciliary components to test for direct effects on axoneme assembly, stability, or function under controlled conditions.

  • Domain-Specific Functional Analysis: Creating chimeric proteins with domains from S. purpuratus and L. pictus SPEC3 could identify regions responsible for species-specific differences in aggregation and function. This would link structural features to specific activities.

  • Optical Control of SPEC3 Function: Incorporating light-sensitive domains into SPEC3 would enable precise temporal control over its activity or localization, allowing researchers to determine exactly when and where SPEC3 function is required during development.

  • Comparative Functional Genomics: Systematic comparison of SPEC3 function across multiple echinoderm species could reveal evolutionary conservation and divergence, providing context for understanding its fundamental versus species-specific roles.

These approaches would address fundamental questions about SPEC3, including its precise function in cilia, the significance of its Golgi association, the role of aggregation in its function, and its position within developmental regulatory networks.

What is known about the evolutionary conservation of SPEC3 and what does this suggest about its fundamental biological role?

The evolutionary conservation of SPEC3 provides important insights into its fundamental biological role. Current evidence suggests:

SPEC3 has been identified in at least two sea urchin species: Strongylocentrotus purpuratus and Lytechinus pictus . In both species, SPEC3 is concentrated in cilia, suggesting a conserved function related to ciliary structure or function.

The conservation of SPEC3's localization to cilia and the Golgi complex across species indicates that its fundamental role in protein trafficking and ciliary function is likely evolutionarily conserved, even as specific biochemical properties may have diverged.

Comparative genomic analysis could identify potential SPEC3 homologs or functionally similar proteins in other deuterostomes, including vertebrates. This would provide a broader evolutionary context for understanding SPEC3's role and significance.

The association of SPEC3 with ectodermal ciliogenesis specifically, rather than all ciliated cells, suggests a specialized role that may have evolved in the context of echinoderm development. This specialization could represent an adaptation related to the particular requirements of ectodermal cilia in these organisms.

Future research should include systematic phylogenetic analysis of SPEC3-like proteins across diverse taxa, correlating evolutionary conservation with functional conservation to identify the core, ancestral role of this protein family in ciliary biology.

How might emerging technologies in protein structure prediction and analysis advance SPEC3 research?

Recent breakthroughs in computational biology, particularly in protein structure prediction and analysis, offer exciting opportunities to advance SPEC3 research:

  • AI-Based Structure Prediction: Tools like AlphaFold2 and RoseTTAFold can now predict protein structures with unprecedented accuracy from sequence data alone. For SPEC3, these approaches could generate structural models even without experimental crystal structures, providing insights into its folding, functional domains, and potential interaction surfaces.

  • Molecular Dynamics Simulations: Advanced simulation techniques can model the dynamic behavior of SPEC3, including its potential conformational changes during trafficking and incorporation into ciliary structures. These simulations could reveal mechanistic details of SPEC3 function that are difficult to capture experimentally.

  • Protein-Protein Interaction Prediction: Computational methods for predicting protein-protein interactions based on sequence and structural features could identify potential binding partners for SPEC3, generating hypotheses about its functional associations that can be tested experimentally.

  • Evolutionary Coupling Analysis: Methods that detect co-evolving residues across protein sequences can identify functionally important regions and interaction interfaces within SPEC3, guiding targeted mutagenesis studies.

  • Integration of Multi-omics Data: Machine learning approaches can integrate diverse data types (genomics, transcriptomics, proteomics, structural data) to build comprehensive models of SPEC3 function in the context of developmental networks and cellular processes.

  • In Silico Screening: Computational screening of small molecule libraries could identify compounds that specifically interact with SPEC3, providing potential tools for functional studies or therapeutic development.

  • Protein Design Applications: Computational protein design could create modified versions of SPEC3 with enhanced stability, altered aggregation properties, or added functional capabilities for experimental studies.

These computational approaches would complement experimental methods, accelerating research by generating specific, testable hypotheses about SPEC3 structure and function. The combination of in silico prediction with targeted experimental validation represents a powerful strategy for understanding this developmentally important protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.