Recombinant Structural polyprotein

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant structural polyproteins are engineered protein constructs comprising multiple covalently linked protein domains or subunits, mimicking natural viral polyproteins or designed for specific functional and structural applications . These synthetic polyproteins enable stoichiometric co-expression of complex protein assemblies, overcoming challenges in producing and stabilizing multi-subunit complexes for structural and functional studies . Their design often incorporates protease cleavage sites for controlled processing, facilitating precise assembly of functional units .

Viral Polymerase Studies

Recombinant polyproteins have been pivotal in resolving structures of influenza virus RNA-dependent RNA polymerases (RdRp). For instance, single-chain polyproteins encoding PA, PB1, and PB2 subunits enabled crystallization and structural determination of bat influenza A polymerase, revealing intricate inter-subunit interactions critical for viral replication .

Mechanism of Nuclear Import

The PA-PB1 heterodimer of influenza polymerase forms a stable complex with RanBP5, a nuclear import factor. SAXS analysis of this complex demonstrated a molecular weight of 323 kDa and an elongated conformation, providing insights into RdRp assembly pathways .

Table 2: SAXS Parameters for PA-PB1(1-686)-RanBP5 Complex

ParameterPA-PB1(1-686)RanBP5PA-PB1-RanBP5 Complex
RgR_g (Å)47.538.851.8
DmaxD_{\text{max}} (Å)128136181
Molecular Mass (Da)146,493144,000323,311

Therapeutic Development

  • High-Affinity Binders: Single-chain polyproteins like PRC1 E2–E3 fusions have been used to study ubiquitination mechanisms, revealing interactions between Ring1B, Bmi1, and nucleosomes .

  • Vaccine Design: Recombinant virus-like particles (VLPs) for polio vaccines incorporate stabilized polyprotein capsids, validated by cryo-electron microscopy (cryoEM) at resolutions ≤3.0 Å .

Biodegradable Materials

BP1, a recombinant structural protein, is efficiently hydrolyzed by environmental bacteria, offering a sustainable alternative to petroleum-based plastics .

Influenza Polymerase Structure Determination

Co-expression of PA, PB1, and PB2 as a polyprotein in insect cells enabled purification of active influenza polymerase, leading to high-resolution X-ray structures that identified PB2 as a bottleneck in recombinant expression . Key findings include:

  • PA-PB1 binds 5′-vRNA with sub-nanomolar affinity, while PB2 is required for 3′-vRNA binding .

  • RanBP5 acts as a chaperone, hindering premature RNA binding during nuclear import .

Environmental Biodegradability

BP1 exhibits 92% mass loss in 28 days under enzymatic hydrolysis, outperforming polylactic acid (PLA) in compostability .

Challenges and Future Directions

  • Expression Optimization: Low yields of PB2 in insect cells limit influenza polymerase production .

  • Immunogenicity: While polypeptides like XTEN show promise as fusion partners, some sequences may trigger immune responses .

  • Scalability: Industrial adoption requires cost-effective production systems, such as yeast or plant-based platforms .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes section, and we will prepare the product accordingly.
Lead Time
Delivery time may differ depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. For multiple use, aliquoting is necessary to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Structural polyprotein; p130
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
820-1258
Protein Length
Full Length of Mature Protein
Species
Middelburg virus
Target Protein Sequence
YEHSVTLPNAVGFPYRAHVDRPGFSPLTLHMEVVSTSLEPTLALDYVTCEYKTVVPSPKV TCCGMSECAHQQKADFQCKVYTGVYPFLWGGAYCFCDSENTQLSEAYVERSEVCKHDHAA AYRAHTAALKAKISVTYGSTNGTAEAFVNGESTARIGDLKMILGPISTAWSPFDPKIVVY KDEVYNQDYPPYGSGQPGRFGDLQSRTTESNDVYANTALKLARPSAGTVHVPYTQTPSGF KYWLKEKGDALNHKAPFGCIIKTNPVRAENCAVGNIPVSLDIPDAAFTRIVDAPSLTGLK CEVATCTHSSDFGGTLVVEYKTDKVGTCAVHSESNTAVMQETSLSVTMDGRGTLHFSTAS ASPSFVLKVCSSKTTCTAKCVPPKDHVVPFPANHNNVVFPDFSSTAVSWLTHTMGGATVV IAIGITIFLIVTCIAFSRH
Uniprot No.

Target Background

Function
The recombinant structural polyprotein assembles into an icosahedral capsid with T=4 symmetry, composed of 240 copies of the capsid protein. This capsid is enveloped by a lipid membrane, through which 80 spikes protrude. Each spike consists of trimers of E1-E2 heterodimers. The capsid protein binds to the viral RNA genome at a site adjacent to a ribosome binding site, facilitating viral genome translation after release. The protein exhibits protease activity, leading to its autocatalytic cleavage from the nascent structural protein. Following self-cleavage, the capsid protein transiently associates with ribosomes. Within minutes, the protein binds to viral RNA and rapidly assembles into icosahedral core particles. Eventually, the nucleocapsid associates with the cytoplasmic domain of the spike glycoprotein E2 at the cell membrane, leading to budding and the formation of mature virions. During infection, new virions attach to target cells and undergo clathrin-mediated endocytosis. Their membrane fuses with the host endosomal membrane, releasing the nucleocapsid into the cytoplasm. Uncoating, essential for accessing the genomic RNA, may be triggered by the interaction of capsid proteins with ribosomes. Binding of ribosomes would release the genomic RNA, as the same region is involved in both genomic RNA binding and ribosome binding. The recombinant structural polyprotein specifically inhibits interleukin-1 receptor-associated kinase 1 (IRAK1)-dependent signaling during viral entry, representing a mechanism by which alphaviruses evade innate immune detection and activation prior to viral gene expression. The protein provides the signal sequence for the translocation of the precursor of protein E3/E2 to the host endoplasmic reticulum. Furin-cleaved E3 remains associated with spike glycoprotein E1, mediating pH protection of the latter during transport via the secretory pathway. After virion release from the host cell, the assembly protein E3 is gradually released into the extracellular space. The recombinant structural polyprotein plays a crucial role in viral attachment to the target host cell by binding to the cell receptor. Synthesized as a p62 precursor, it is processed by furin at the cell membrane just before virion budding, yielding the E2-E1 heterodimer. The p62-E1 heterodimer is stable, while E2-E1 is unstable and dissociates at low pH. p62 is processed in the final step, likely to prevent premature E1 fusion activation before its final export to the cell surface. The C-terminus of E2 contains a transitory transmembrane domain that is disrupted by palmitoylation, resulting in the reorientation of the C-terminal tail from the lumenal to the cytoplasmic side. This step is critical because the E2 C-terminus interacts with capsid proteins during budding. This release of the E2 C-terminus in the cytoplasm occurs late in protein export, preventing premature assembly of particles at the endoplasmic reticulum membrane. The recombinant structural polyprotein is a constitutive membrane protein involved in virus glycoprotein processing, cell permeabilization, and the budding of viral particles. It disrupts the calcium homeostasis of the cell, likely at the endoplasmic reticulum level. This leads to elevated cytoplasmic calcium levels. Due to its lipophilic properties, the 6K protein is thought to influence the selection of lipids that interact with the transmembrane domains of the glycoproteins. This, in turn, affects the deformability of the bilayer required for the extreme curvature that occurs during budding. The 6K protein is present in low amounts in virions, approximately 3% compared to viral glycoproteins. The recombinant structural polyprotein is a Class II viral fusion protein. Its fusion activity remains inactive as long as E1 is bound to E2 in the mature virion. After virus attachment to the target cell and endocytosis, acidification of the endosome induces the dissociation of the E1/E2 heterodimer, accompanied by the trimerization of the E1 subunits. This E1 trimer becomes fusion-active and promotes the release of the viral nucleocapsid into the cytoplasm after endosome and viral membrane fusion. Efficient fusion requires the presence of cholesterol and sphingolipid in the target membrane. Fusion is optimal at levels of about 1 molecule of cholesterol per 2 molecules of phospholipids and is specific for sterols containing a 3-beta-hydroxyl group.
Subcellular Location
[Capsid protein]: Virion. Host cytoplasm. Host cell membrane. Host nucleus.; [Spike glycoprotein E2]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.; [6K protein]: Host cell membrane; Multi-pass membrane protein. Virion membrane; Multi-pass membrane protein.; [Spike glycoprotein E1]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What are structural polyproteins and how do they differ from regular proteins?

Structural polyproteins are chains of covalently conjoined smaller proteins that exist both naturally and as engineered constructs. Unlike individual proteins with singular functions, polyproteins contain multiple protein domains within a single polypeptide chain. In viral systems, polyproteins typically undergo proteolytic processing to release individual functional proteins during maturation. Natural polyproteins occur predominantly in viruses, including HIV, where the viral genome encodes polyproteins from genes like gag, pol, and env . There are also tandemly repetitive polyproteins (TRPs) found in organisms like nematodes, which consist of consecutively arranged repeats of amino acid stretches that are processed into multiple copies of proteins with similar functions .

How have polyproteins contributed to structural biology advancements?

Polyproteins have enabled several significant breakthroughs in structural biology, particularly for previously inaccessible protein complexes. Key contributions include:

  • Determination of native HIV Gag polyprotein architecture using cryo-electron microscopy of immature capsids

  • Resolution of the long-elusive influenza polymerase structure through synthetic polyprotein approaches

  • Facilitation of high-resolution structural studies of complex membrane proteins like G-protein coupled receptors through insertion of stabilizing domains

  • Development of novel methodologies for single-molecule analysis of protein folding mechanisms

Polyproteins have proven especially valuable for overcoming technical challenges in protein expression and purification, yielding structural insights that inform antiviral intervention strategies and fundamental biological mechanisms.

What statistical approaches optimize recombinant polyprotein expression?

Factorial experimental design represents a powerful statistical approach for optimizing recombinant polyprotein expression. Unlike traditional one-variable-at-a-time methods, factorial design enables:

  • Simultaneous evaluation of multiple variables affecting expression

  • Identification of interactive effects between variables

  • Reduction in the number of experiments required

  • Quantitative modeling of optimal conditions

For example, in the optimization of recombinant pneumolysin expression, researchers applied a 2^8-4 fractional factorial design to evaluate eight variables simultaneously, including medium composition components and induction conditions . This approach allowed researchers to identify statistically significant variables affecting both cell growth and soluble protein expression while minimizing experimental resources.

The advantages of factorial design over traditional approaches include:

AspectTraditional One-variable ApproachFactorial Design Approach
Number of experimentsHighReduced
Interactive effectsNot detectedIdentified
Resource requirementsGreaterMinimized
Statistical confidenceLowerHigher
Optimization efficiencyLowHigh

This statistical methodology has successfully optimized numerous bioprocesses but remains underutilized for heterologous protein expression systems .

What are the critical variables affecting soluble expression of recombinant polyproteins?

Based on experimental design studies, several critical variables significantly impact the soluble expression of recombinant polyproteins:

  • Temperature: Post-induction temperature dramatically affects protein folding and solubility, with lower temperatures (25°C) often favoring soluble expression compared to standard growth temperatures (37°C) .

  • Inducer concentration: Lower IPTG concentrations (0.1 mM) frequently result in higher proportions of soluble protein by slowing expression rate and allowing proper folding .

  • Medium composition: The balance of nutrients in expression media significantly impacts soluble protein yield:

    • Yeast extract concentration (optimal range: 5 g/L)

    • Tryptone levels (optimal range: 5 g/L)

    • Carbon source type and concentration (glucose vs. glycerol)

  • Induction timing: Cell density at induction (measured by absorbance) affects the metabolic state of cells and consequently protein expression patterns. Induction at mid-log phase (OD600 of 0.8) often provides optimal results .

  • Expression duration: Optimal expression time (4 hours) balances maximum protein accumulation against potential aggregation or degradation .

These variables should be systematically optimized for each specific polyprotein construct, as the optimal conditions may vary based on the protein's structural characteristics and expression system.

How are cryo-electron microscopy techniques applied to polyprotein architecture studies?

Cryo-electron microscopy (cryo-EM) has become instrumental in revealing the native architecture of polyproteins, particularly viral polyproteins like HIV Gag. The technique offers several advantages:

  • Native state preservation: Flash-freezing samples preserves polyproteins in near-native conformations without crystallization requirements .

  • Visualization of assembly intermediates: Cryo-EM allows visualization of polyproteins in various stages of processing, including immature viral capsids before proteolytic cleavage .

  • Resolution of dynamic regions: Modern cryo-EM techniques can resolve regions of polyproteins that may be too flexible for crystallography, providing insights into conformational changes during maturation .

In HIV research, cryo-EM revealed the arrangement of Gag polyproteins in immature capsids, showing how these precursor proteins organize into a lattice structure before proteolytic processing. This structural information provides crucial insights for antiviral development targeting assembly intermediates .

What role does single-molecule analysis play in understanding polyprotein folding mechanics?

Single-molecule analysis using atomic force microscopy (AFM) has emerged as a powerful technique for investigating polyprotein folding mechanics:

  • Mechanical fingerprinting: AFM measures unique mechanical response profiles when force is applied to polyproteins, revealing properties not observable in bulk assays .

  • Statistical advantages: Using polyproteins in single-molecule AFM improves statistical evaluation of individual domains within the polyprotein chain compared to monomeric proteins .

  • Reference systems: Well-characterized homomeric polyproteins (like poly-I27 derived from titin) serve as reference systems in chimeric constructs to study uncharacterized proteins .

Multiple polyprotein systems have been analyzed via this approach, including:

  • Poly-I27 (from titin's I-band region)

  • Oligo-calmodulin

  • Poly-ubiquitin

  • Polyproteins derived from Peptostreptococcus magnus virulence factor GB1

These studies have provided unique insights into biological folding/unfolding mechanisms at the single-molecule level that complement bulk structural studies.

How has polyprotein technology resolved protein complex expression bottlenecks?

Polyprotein technology has overcome significant bottlenecks in the expression and structural characterization of challenging protein complexes through several innovative approaches:

  • Co-expression of multiple subunits: Encoding multiple subunits of a protein complex in a single polyprotein ensures stoichiometric production and co-localization during folding .

  • Self-processing systems: Incorporating viral protease recognition sites between protein domains enables auto-processing into individual components after proper folding has occurred .

  • Stabilization of flexible regions: Engineering covalent linkages between interacting domains can stabilize otherwise flexible interfaces, facilitating crystallization .

A landmark example is the influenza polymerase complex, which remained structurally uncharacterized for over 40 years despite its crucial role in viral replication. Using a synthetic polyprotein approach with baculovirus-infected insect cells, researchers finally achieved high-resolution crystal structures of this complex . The polyprotein was designed to undergo proteolytic processing into constituent subunits after expression, yielding functional complexes suitable for crystallization.

What engineering strategies improve polyprotein design for structural studies?

Several engineering strategies have proven effective for optimizing polyproteins for structural studies:

  • Linker optimization: The length and composition of linkers between protein domains critically affect folding, flexibility, and function:

    • Glycine-rich linkers provide flexibility

    • Proline-containing linkers introduce rigidity

    • Charged residues enhance solubility

  • Domain arrangement: The order of domains within a polyprotein affects expression, folding, and function, requiring empirical optimization .

  • Fusion with stability enhancers: Strategic insertion of highly stable protein domains (e.g., T4 lysozyme) can enhance expression and crystallization properties:

    • Used successfully for G-protein coupled receptors (GPCRs)

    • Applied in the crystal structure determination of human OX₂ orexin receptor

  • Protease site engineering: For self-processing polyproteins, optimizing protease recognition sequences ensures efficient and specific cleavage .

These strategies have enabled the structural determination of previously intractable protein complexes, including membrane proteins and dynamic multi-subunit assemblies.

How can inclusion body formation be minimized during recombinant polyprotein expression?

Inclusion body formation represents a significant challenge in recombinant polyprotein expression. Several strategies have proven effective in minimizing insoluble aggregation:

  • Expression temperature optimization: Lowering the post-induction temperature (typically to 16-25°C) slows protein synthesis, allowing more time for proper folding and reducing inclusion body formation .

  • Induction optimization:

    • Reducing inducer concentration (e.g., 0.1 mM IPTG instead of 1 mM)

    • Inducing at optimal cell density (typically mid-log phase, OD₆₀₀ of 0.8)

  • Media composition adjustment:

    • Including glucose (1 g/L) to suppress basal expression

    • Optimizing nitrogen sources (5 g/L yeast extract, 5 g/L tryptone)

  • Co-expression with chaperones: Molecular chaperones like GroEL/GroES, DnaK/DnaJ/GrpE, or trigger factor can assist proper folding .

The multivariate experimental design approach is particularly valuable for identifying optimal combinations of these parameters, as they often interact in complex ways that cannot be predicted by altering one variable at a time .

What analytical methods best verify correct folding of recombinant polyproteins?

Verifying the correct folding of recombinant polyproteins requires multiple complementary analytical approaches:

  • Activity assays: Functional assays provide the most relevant assessment of proper folding. For example, hemolytic activity assays can verify correct folding of pneumolysin polyprotein derivatives .

  • Size exclusion chromatography: Analyzes the oligomeric state and homogeneity of the purified polyprotein, distinguishing between monomeric, oligomeric, and aggregated forms .

  • Circular dichroism spectroscopy: Provides information about secondary structure content to verify proper folding .

  • Limited proteolysis: Correctly folded proteins typically show resistance to proteolysis at specific sites compared to misfolded variants .

  • Thermal shift assays: Measures protein stability through denaturation profiles, with well-folded proteins typically showing cooperative unfolding transitions .

For polyproteins destined for structural studies, preliminary small-scale crystallization trials can also serve as a sensitive indicator of proper folding and sample homogeneity prior to investing in large-scale purification and crystallization efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.