Recombinant Struthio camelus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome c oxidase (COX), a vital mitochondrial metalloenzyme, functions as the terminal enzyme of the respiratory chain . It plays a crucial role in cellular respiration in both eukaryotes and prokaryotes . Within this enzyme complex lies Cytochrome c oxidase subunit 2 (MT-CO2), a protein encoded by mitochondrial DNA (mtDNA). Understanding the structure, function, and genetic characteristics of MT-CO2 is paramount in studying mitochondrial diseases and the evolutionary relationships between species.

General Information

Struthio camelus refers to the Ostrich, the world's largest living bird species . MT-CO2, when isolated and produced using recombinant DNA technology, is referred to as Recombinant Struthio camelus Cytochrome c Oxidase Subunit 2. This recombinant form allows for detailed studies of the protein's properties and functions in a controlled environment.

Protein Structure and Function

MT-CO2 is a critical subunit of the COX enzyme complex, which is responsible for catalyzing the transfer of electrons from cytochrome c to molecular oxygen, contributing to the generation of a proton gradient that drives ATP synthesis . The protein contains transmembrane domains that anchor it within the mitochondrial inner membrane.

Genetic Characteristics

The gene encoding MT-CO2 is located on the mitochondrial genome. Mutations in this gene have been associated with mitochondrial diseases, affecting the synthesis or stability of the COX complex .

Isolation and Recombinant Production

Recombinant MT-CO2 can be produced by isolating the gene encoding the protein from Struthio camelus, cloning it into an expression vector, and expressing it in a host organism such as E. coli or yeast. The recombinant protein can then be purified for downstream applications.

Research Applications

Recombinant Struthio camelus MT-CO2 is useful in various research areas:

  • Structural Studies: Enables detailed structural determination using X-ray crystallography or NMR spectroscopy.

  • Enzyme Kinetics: Facilitates studies on the enzyme's catalytic mechanism and the effects of inhibitors.

  • Mitochondrial Dysfunction: Aids in understanding the impact of MT-CO2 mutations on mitochondrial function and disease.

  • Phylogenetic Studies: Useful for examining evolutionary relationships among different species .

Mutations and Mitochondrial Disease

Mutations in the MT-CO2 gene can lead to mitochondrial dysfunction . For example, a mutation in the initiation codon of the MT-CO2 gene has been shown to result in lower levels of the protein and COX deficiency . Such mutations can impair the electron transport chain, leading to a variety of clinical manifestations, including muscle weakness and neurological problems .

Comparative Studies

Comparative modeling and docking studies involving Cytochrome c oxidase subunit 1 protein from different species, including Struthio camelus, have been conducted using homology modeling software . These studies help in understanding the molecular interactions of compounds with the protein and identifying potential drug targets .

Methane Emission Studies

Research has been conducted on methane emissions by Struthio camelus, indicating similarities with nonruminant mammalian herbivores . Although this is not directly related to MT-CO2, it highlights the broader research interest in the physiology and environmental impact of ostriches .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance, incurring additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Struthio camelus (Common ostrich)
Target Names
Target Protein Sequence
MANPSQFGFQDASSPIMEELVEFHDHALMVALAICSLVLYLLALMLVEKLSSNTVDAQEV ELIWTILPAIVLILLALPSLQILYMMDEIDEPDLTLKAIGHQWYWSYEYTDFKDLTFDSY MIPTSELPPGHFRLLEVDHRVVVPMESPIRVIITAGDVLHSWAVPTLGVKTDAIPGRLNQ TSFITTRPGIFYGQCSEICGANHSYMPIVVESTPLTYFESWSSLLSTDS
Uniprot No.

Target Background

Function
Recombinant Struthio camelus Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaboratively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) comprising heme A3 and copper B (CuB). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How has MT-CO2 evolved in ostriches compared to other species?

Cytochrome c oxidase subunits show evidence of adaptive evolution across species. In camelids, MT-CO2 has undergone replacements in sites otherwise conserved in other cetartiodactyls, particularly showing an increased relative evolutionary rate . Similar patterns may exist in ostrich MT-CO2.

Analysis of MT-CO2 sequence variations between ostriches and other birds reveals adaptations potentially related to their unique physiology as large, flightless birds adapted to arid environments. Notably, while most research on anaerobic adaptations has focused on mammals, recent studies have identified a distinctive anaerobic gut fungal community in ostriches that diverged approximately 30 million years ago, coinciding with ostrich evolution .

A comparative analysis of the redox centers and transmembrane domains would likely reveal adaptations specific to the ostrich's unique metabolism and environmental niche.

What expression systems are optimal for producing recombinant Struthio camelus MT-CO2?

E. coli is the predominant expression system for recombinant MT-CO2 production. For optimal expression:

  • Vector design considerations:

    • Include an N-terminal His-tag for purification

    • Optimize codon usage for E. coli

    • Include appropriate signal sequences if membrane insertion is desired

  • Expression conditions:

    • Use E. coli strains expressing the System I (CcmABCDEFGH) cytochrome c biogenesis pathway for proper heme attachment

    • Induce with IPTG at lower temperatures (16-25°C) to enhance proper folding

    • Include supplements like δ-aminolevulinic acid (ALA) to support heme synthesis

  • Buffer optimization during purification:

    • Typical storage buffer: Tris-based buffer with 50% glycerol

    • For reconstitution: Tris or phosphate buffer with controlled ionic strength

This approach allows for the production of functional recombinant protein suitable for structural and functional studies.

What are the critical factors for successful recombinant expression of functional MT-CO2?

The production of functional recombinant MT-CO2 faces several challenges that must be addressed methodically:

ChallengeSolutionRationale
Membrane protein solubilityInclude detergents (DDM, LDAO) in purification buffersMaintains proper folding of transmembrane helices
Heme incorporationCo-express with CcmABCDEFGH systemEnsures proper biogenesis of holocytochrome c species
Copper center formationInclude copper salts in growth mediaProvides necessary cofactor for CuA center assembly
Protein aggregationLower induction temperature (16-20°C)Slows expression rate, promoting proper folding
Proteolytic degradationAdd protease inhibitors during cell lysisPrevents degradation during purification

The biogenesis pathway is particularly critical. As demonstrated in studies of cytochrome c, the System I pathway (CcmABCDEFGH) is essential for recombinant expression of functional protein with properly attached heme groups . Without this pathway, the resulting protein lacks the proper cofactors required for electron transport function.

How can researchers verify the structural integrity of recombinant Struthio camelus MT-CO2?

Multiple complementary techniques should be employed to verify structural integrity:

  • Spectroscopic analysis:

    • UV-visible spectroscopy to confirm heme incorporation (characteristic absorption peaks at ~410 nm and ~550-560 nm)

    • Circular dichroism (CD) to assess secondary structure content

    • Electron paramagnetic resonance (EPR) to examine the CuA center

  • Biochemical verification:

    • Heme stain analysis following SDS-PAGE to confirm covalent heme attachment

    • Western blotting with antibodies against conserved MT-CO2 epitopes

    • Limited proteolysis to assess proper folding

  • Functional assays:

    • Electron transfer activity measurement using reduced cytochrome c as substrate

    • Oxygen consumption assays similar to those used for native enzyme (typical rates for functional cytochrome c oxidase: 18.25-18.75 nmol O₂/min per 3×10⁷ cells)

Loss of function may indicate improper folding, absence of cofactors, or compromised copper centers.

What approaches can address the challenges of MT-CO2's membrane integration for structural studies?

MT-CO2 contains transmembrane domains that complicate structural studies. Researchers can employ several strategies:

  • Protein engineering approaches:

    • Introduction of solubility-enhancing mutations (similar to the W56R mutation in yeast Cox2 that diminishes transmembrane helix hydrophobicity)

    • Creation of fusion constructs with soluble proteins

    • Truncation of transmembrane domains while preserving the CuA center

  • Membrane mimetic systems:

    • Detergent micelles (DDM, LDAO)

    • Nanodiscs with defined lipid composition

    • Amphipols for enhanced stability

  • Crystallization strategies:

    • Lipidic cubic phase (LCP) crystallization

    • Antibody fragment (Fab/nanobody) co-crystallization to increase polar surface area

  • Alternative structural approaches:

    • Cryo-electron microscopy for structure determination without crystallization

    • NMR studies of specifically labeled domains

Each approach offers different advantages and may provide complementary structural information about ostrich MT-CO2.

How can site-directed mutagenesis of MT-CO2 reveal electron transfer mechanisms specific to ostriches?

Strategic mutagenesis of key residues in Struthio camelus MT-CO2 can provide insights into electron transfer mechanisms unique to this species:

  • Key targets for mutagenesis:

    • Conserved cysteine residues that coordinate the CuA center

    • Residues at the interface with cytochrome c

    • Amino acids unique to ostrich MT-CO2 compared to other avian species

  • Electron transfer analysis methods:

    • Stopped-flow spectroscopy to measure electron transfer kinetics

    • Temperature-dependent kinetics to determine activation parameters

    • pH-dependent studies to identify critical protonation states

  • Experimental design framework:

    • Create a mutation series comparing conserved vs. ostrich-specific residues

    • Express both wild-type and mutant proteins under identical conditions

    • Perform parallel analyses of electron transfer rates and oxygen consumption

Specific attention should be given to residues similar to position 115, where in camelids a D→T substitution may modify electrostatic interactions with cytochrome c , potentially affecting electron transfer efficiency.

What insights can be gained by investigating MT-CO2's role in ostrich respiratory adaptations?

Ostriches possess unique respiratory adaptations that may be reflected in MT-CO2 properties:

  • Oxygen affinity investigations:

    • Measure oxygen binding kinetics of reconstituted cytochrome c oxidase containing ostrich MT-CO2

    • Compare with enzymes containing MT-CO2 from other bird species

    • Correlate with whole blood oxygen affinity parameters (ostriches have higher whole blood oxygen affinity associated with inositol tetrakisphosphate)

  • Temperature adaptation studies:

    • Analyze thermal stability of ostrich MT-CO2

    • Determine temperature optima for electron transfer activity

    • Investigate structural adaptations that enable function at the elevated body temperature of ostriches (38-39°C)

  • Altitude adaptation analysis:

    • Compare MT-CO2 sequences from ostrich populations at different altitudes

    • Assess whether variations correlate with oxygen availability

    • Examine potential parallels with adaptations seen in high-altitude birds

These investigations could reveal molecular adaptations that support the ostrich's unique physiology as a large, flightless bird adapted to diverse environmental conditions.

How does MT-CO2 integrate into the complete cytochrome c oxidase complex in ostriches?

Understanding assembly of the complete cytochrome c oxidase complex requires sophisticated experimental approaches:

  • Assembly intermediate identification:

    • Pulse-chase labeling combined with immunoprecipitation to track incorporation of newly synthesized MT-CO2 into assembly intermediates

    • Blue Native PAGE to separate and identify assembly intermediates

    • Mass spectrometry to characterize protein composition of isolated complexes

  • Assembly factor identification:

    • Identify ostrich homologs of known assembly factors (Cox18p, Mss2p, Pnt1p)

    • Characterize their interactions with MT-CO2 using co-immunoprecipitation

    • Investigate whether ostrich-specific assembly factors exist

  • Membrane insertion studies:

    • Analysis of TIM23-dependent membrane insertion efficiency

    • Investigation of factors affecting translocation of ostrich MT-CO2

    • Comparison with insertion mechanisms in other species

This research would provide insights into whether the assembly pathway of cytochrome c oxidase in ostriches has unique features compared to other birds or mammals.

What evolutionary patterns can be identified by comparing MT-CO2 across ratite species?

Comparative analysis of MT-CO2 across ratites (large flightless birds) can reveal evolutionary patterns:

  • Sequence and structural comparison framework:

    • Align MT-CO2 sequences from ostriches, emus, cassowaries, kiwis, and rheas

    • Identify conserved vs. variable regions

    • Map variations onto structural models to assess functional significance

  • Molecular evolution analysis:

    • Calculate dN/dS ratios to identify sites under positive selection

    • Perform ancestral sequence reconstruction to track evolutionary changes

    • Estimate divergence times of key adaptations in relation to speciation events

  • Correlation with ecological factors:

    • Analyze whether MT-CO2 variations correlate with habitat differences

    • Examine potential links to body size (which varies dramatically among ratites)

    • Investigate correlations with metabolic rate differences

Such analysis could determine whether independent evolution of flightlessness in ratite lineages involved convergent adaptations in MT-CO2 or diverse molecular solutions to similar physiological challenges.

How do mitochondrial adaptations in ostriches compare with adaptations in their unique gut microbiome?

Recent research has identified specialized anaerobic gut fungi in ostriches that play an essential role in plant biomass degradation . This raises intriguing questions about potential co-evolution of mitochondrial and microbial adaptations:

  • Co-evolutionary analysis:

    • Compare evolutionary rates of MT-CO2 with diversification rates of gut microbiota

    • Investigate whether molecular dating of MT-CO2 adaptations corresponds with gut microbiome evolution (approximately 30 Mya for ostrich gut fungi)

    • Analyze whether similar patterns exist in other ratites

  • Metabolic interaction studies:

    • Investigate effects of gut microbial metabolites on mitochondrial function

    • Examine whether ostrich MT-CO2 has adaptations related to processing specific metabolites

    • Study whether the unique energy extraction system provided by gut symbionts correlates with adaptations in energy utilization systems

  • Comparative analysis across species:

    • Extend analysis to other hindgut fermenting birds

    • Compare with patterns in mammals with similar digestive adaptations

    • Identify convergent vs. divergent evolutionary patterns

This integrative approach could reveal previously unrecognized connections between gut microbial adaptations and mitochondrial function.

What experimental protocols optimize the use of recombinant MT-CO2 in inhibitor screening studies?

Researchers investigating potential inhibitors can follow this methodological framework:

  • Assay development:

    • Establish a spectrophotometric assay monitoring cytochrome c oxidation at 550 nm

    • Optimize buffer conditions (pH 7.0-7.5, ionic strength, detergent concentration)

    • Develop alternative assays (oxygen consumption, membrane potential changes) for confirmation

  • Screening protocol design:

    • Use 96-well format for higher throughput

    • Include appropriate controls (known inhibitors like cyanide)

    • Establish Z-factor for assay quality assessment

  • Data analysis methodology:

    • Determine IC₅₀ values through dose-response curves

    • Analyze inhibition mechanisms (competitive, non-competitive)

    • Perform structure-activity relationship studies for hit compounds

This approach would enable efficient screening of compound libraries while ensuring reproducible results.

How can researchers effectively reconstitute recombinant MT-CO2 with other subunits to form functional cytochrome c oxidase?

Reconstitution of functional cytochrome c oxidase requires carefully controlled conditions:

  • Subunit expression and purification:

    • Express each subunit separately with appropriate tags

    • Purify under conditions that maintain native-like structure

    • Verify cofactor incorporation before reconstitution

  • Reconstitution methodology:

    • Combine purified subunits in appropriate stoichiometric ratios

    • Use controlled detergent concentrations (typically 0.1-0.5% DDM)

    • Add specific lipids required for optimal activity (cardiolipin is often critical)

  • Functional verification:

    • Measure electron transfer activity

    • Compare kinetic parameters with native enzyme

    • Assess proton pumping capability in reconstituted proteoliposomes

  • Troubleshooting common issues:

    • Insufficient activity: Adjust lipid composition or cofactor availability

    • Instability: Modify buffer conditions or add stabilizing agents

    • Incomplete assembly: Adjust order of subunit addition or include assembly factors

This methodical approach enables the creation of functional complexes for mechanistic studies.

What considerations are important when designing antibodies against Struthio camelus MT-CO2 for structural and functional studies?

Development of specific antibodies requires careful epitope selection and validation:

  • Epitope selection strategies:

    • Target regions unique to ostrich MT-CO2 for species-specificity

    • Choose surface-exposed regions based on structural models

    • Avoid highly conserved functional domains if conformational sensitivity is a concern

  • Antibody development methodology:

    • Generate both polyclonal (for multiple epitope recognition) and monoclonal (for specificity) antibodies

    • Use synthetic peptides or recombinant protein fragments as immunogens

    • Include appropriate carrier proteins for small epitopes

  • Validation protocols:

    • Verify specificity through Western blotting against ostrich tissue extracts

    • Confirm recognition of recombinant protein

    • Test cross-reactivity with MT-CO2 from other species

    • Validate functionality in immunoprecipitation experiments

  • Applications in structural studies:

    • Use Fab fragments for co-crystallization to increase polar surface area

    • Employ antibodies to stabilize specific conformational states

    • Utilize for identification of assembly intermediates

These considerations ensure development of antibodies that serve as valuable tools for both structural and functional studies of ostrich MT-CO2.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.