Recombinant Struthio camelus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is synthesized using bacterial expression systems:

ParameterSpecification
Host SystemEscherichia coli
Expression VectorCustom-designed plasmid with codon optimization for prokaryotic hosts
Purification MethodAffinity chromatography (>85% purity via SDS-PAGE)
StorageLyophilized or liquid form at -20°C/-80°C; avoid freeze-thaw cycles

The inclusion of a His-tag facilitates purification, though the exact tag position (N-terminal) varies by production batch .

Functional Role in Mitochondrial Respiration

As a subunit of Complex I, MT-ND4L contributes to:

  • Electron Transfer: Mediates electron movement from NADH to ubiquinone, initiating the proton gradient .

  • Proton Pumping: Conformational changes during redox reactions enable translocation of 4 H+ ions per NADH oxidized .

  • Structural Stability: Hydrophobic interactions with other core subunits (ND1, ND2, ND3) stabilize the transmembrane helix bundle .

Mutations in MT-ND4L homologs are linked to mitochondrial disorders like Leber’s hereditary optic neuropathy (LHON), underscoring its functional importance .

Research Applications

Recombinant Struthio camelus MT-ND4L is utilized in:

  • Mechanistic Studies: Investigating electron transport chain dysfunction in metabolic diseases .

  • Antibody Production: Serving as an antigen for immunoassays targeting mitochondrial proteins .

  • Comparative Biology: Analyzing evolutionary conservation of Complex I subunits across species .

Challenges and Future Directions

Current limitations include low solubility due to hydrophobicity, necessitating detergent-based reconstitution . Future research may focus on:

  • Crystallization: Solving high-resolution structures to elucidate proton-pumping mechanisms.

  • Therapeutic Screening: Targeting MT-ND4L in mitochondrial disease models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Struthio camelus (Common ostrich)
Target Names
Target Protein Sequence
MSFLHLSFYSAFTLSSLGLAFHRTHLISALLCLESMMLSLYLALSIWPVQAQTPSFTLVP ILMLAFSACEAGTGLAMLVASTRTHGSDHLHNLNLLQC
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) is believed to be a component of the minimal assembly required for catalysis. Complex I plays a crucial role in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of Struthio camelus MT-ND4L protein?

The MT-ND4L protein from Struthio camelus (ostrich) is a small, hydrophobic subunit of Complex I in the mitochondrial electron transport chain. While specific structural data for the ostrich variant is limited, the MT-ND4L protein is generally characterized by:

  • Molecular weight of approximately 11 kDa

  • Composition of approximately 98 amino acids

  • Highly hydrophobic profile, forming part of the core transmembrane region of Complex I

  • L-shaped structure with a transmembrane domain

The ostrich MT-ND4L, like other vertebrate homologs, likely forms part of the minimal assembly required for the functional core of Complex I. Phylogenetic analyses using mitochondrial genome sequences have been used to establish evolutionary relationships between caecilians and other vertebrates, including Struthio camelus .

How does recombinant Struthio camelus MT-ND4L differ from its native form?

Recombinant Struthio camelus MT-ND4L differs from its native form in several important aspects:

  • Expression system alterations: Recombinant proteins are typically produced in non-native host systems (E. coli, yeast, insect cells), which may introduce variations in post-translational modifications

  • Addition of purification tags: Most recombinant proteins include His-tags or other fusion partners that facilitate purification but may affect structure and function

  • Solubility challenges: The highly hydrophobic nature of MT-ND4L often requires specialized detergent solubilization methods when expressed recombinantly

  • Absence of native interaction partners: The recombinant form lacks the complex assembly context of the mitochondrial inner membrane

When working with recombinant MT-ND4L, researchers must account for these differences when designing experiments to study protein function or when using it for antibody production.

What expression systems are most effective for recombinant Struthio camelus MT-ND4L production?

Based on general approaches for mitochondrial proteins similar to MT-ND4L, the following expression systems have demonstrated various effectiveness:

Expression SystemAdvantagesChallengesTypical Yield
E. coliCost-effective, rapid growth, established protocolsLacks mitochondrial-specific chaperones, inclusion body formation common0.5-3 mg/L culture
Insect cellsBetter for membrane proteins, superior foldingHigher cost, longer production time2-5 mg/L culture
Mammalian cellsMost natural post-translational modificationsHighest cost, complex media requirements0.5-2 mg/L culture
Cell-free systemsAvoids toxicity issues, rapid productionLimited scale, expensive0.1-0.5 mg/reaction

For MT-ND4L specifically, membrane-mimetic environments are crucial during purification due to its hydrophobic nature. Codon optimization for the expression host is particularly important for the ostrich sequence, as codon usage differs significantly between avian and prokaryotic systems .

What purification strategies are recommended for recombinant Struthio camelus MT-ND4L?

Purification of recombinant MT-ND4L requires specialized approaches due to its hydrophobic nature:

  • Solubilization optimization: Screen various detergents (DDM, LDAO, Triton X-100) to effectively extract the protein from membranes

  • Affinity chromatography: Utilize N- or C-terminal tags (His6, GST, MBP) for initial capture

  • Size exclusion chromatography: Remove aggregates and separate oligomeric states

  • Ion exchange chromatography: Further purify based on surface charge characteristics

Critical considerations include maintaining a detergent concentration above critical micelle concentration throughout purification and avoiding detergent exchange steps that may induce protein precipitation. Temperature control (4°C) throughout the purification process is essential to maintain protein stability .

How can researchers effectively analyze the interaction between recombinant Struthio camelus MT-ND4L and other Complex I subunits?

Analyzing interactions between recombinant MT-ND4L and other Complex I components requires sophisticated approaches:

  • Co-immunoprecipitation with specific modifications:

    • Crosslink proteins prior to cell lysis to capture transient interactions

    • Use membrane-compatible detergents (digitonin, DDM) at minimal effective concentrations

    • Include phospholipids to stabilize the membrane protein complexes

  • Microscale Thermophoresis (MST):

    • Label-free detection of biomolecular interactions in solution

    • Can work with detergent-solubilized membrane proteins

    • Allows determination of binding affinities (KD values)

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps interaction interfaces at peptide resolution

    • Can identify conformational changes upon binding

    • Works effectively with membrane proteins in detergent micelles

  • Bioluminescence Resonance Energy Transfer (BRET):

    • Engineer fusion constructs with appropriate donor/acceptor pairs

    • Allows real-time monitoring of interactions in living cells

    • Can detect conformational changes during electron transport

When analyzing MT-ND4L interactions, it's critical to consider its unusual genetic feature: the 7-nucleotide gene overlap with MT-ND4, which may have functional significance for coordinated expression and assembly of these adjacent components in the complex .

What are the experimental challenges in studying the contribution of Struthio camelus MT-ND4L to Complex I electron transport function?

Studying the specific contribution of MT-ND4L to Complex I function presents multiple technical challenges:

  • Functional reconstitution difficulties:

    • Recombinant MT-ND4L must be correctly integrated into liposomes or nanodiscs

    • Complete functional Complex I contains 45+ subunits, making full reconstitution challenging

    • Specific contribution of single subunits is difficult to isolate

  • Electron paramagnetic resonance (EPR) spectroscopy limitations:

    • Requires specialized equipment and expertise

    • Signal attribution to specific subunits requires site-directed mutagenesis

    • Sample preparation must maintain redox center integrity

  • Measuring proton pumping activity:

    • Requires pH-sensitive probes in reconstituted systems

    • Differentiation between direct and indirect effects of MT-ND4L mutations

    • Control experiments must account for membrane leakage

  • Electrophysiological measurements:

    • Patch-clamp techniques require specialized membrane preparations

    • Signal-to-noise ratio challenges with single-subunit contributions

    • Difficult to distinguish from other mitochondrial channel activities

Researchers typically address these challenges through comparative studies using site-directed mutagenesis of conserved residues, coupled with comprehensive functional assays that measure NADH oxidation rates, superoxide production, and membrane potential generation .

How can researchers investigate the evolutionary conservation of MT-ND4L between Struthio camelus and other vertebrates?

Investigating evolutionary conservation of MT-ND4L requires multifaceted approaches:

  • Comprehensive phylogenetic analysis:

    • Collect MT-ND4L sequences from diverse vertebrate lineages

    • Apply appropriate evolutionary models (mtREV for mitochondrial proteins)

    • Use maximum likelihood, Bayesian, and parsimony methods to construct robust phylogenies

    • Bootstrap analyses with 1000+ pseudoreplications to test robustness

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under positive or purifying selection

    • Use Branch-site models to detect lineage-specific selection patterns

    • Compare ratios across different vertebrate clades to identify evolutionary shifts

  • Structural conservation mapping:

    • Map conserved residues onto predicted structural models

    • Identify functional domains with highest conservation

    • Compare transmembrane topology predictions across lineages

Phylogenetic analyses have shown that mitochondrial genome sequences are valuable for resolving evolutionary relationships among vertebrates, including the placement of Struthio camelus and understanding the phylogenetic position of caecilians in amphibian evolution .

What approaches can resolve conflicting experimental data on MT-ND4L function in oxidative phosphorylation?

When confronted with conflicting experimental results regarding MT-ND4L function:

  • Systematic protocol standardization:

    • Develop consensus protocols for protein preparation and functional assays

    • Standardize detergent types, concentrations, and buffer compositions

    • Establish reference materials for inter-laboratory validation

  • Multi-method validation approach:

    • Apply orthogonal techniques to the same research question

    • Combine in vitro biochemical assays with cellular and in vivo models

    • Use both direct (enzymatic) and indirect (respiration) functional measurements

  • Controlled environmental variables:

    • Test function under precisely controlled temperature, pH, and ionic conditions

    • Evaluate oxygen tension effects on experimental outcomes

    • Assess the impact of lipid composition on protein function

  • Meta-analysis of experimental data:

    • Perform statistical analysis of compiled datasets from multiple studies

    • Weight results based on methodological rigor and sample size

    • Identify potential sources of systematic error

The hydrophobic nature of MT-ND4L makes it particularly susceptible to experimental variability based on solubilization and reconstitution conditions, which must be carefully controlled and reported to allow meaningful comparison between studies .

What are the best approaches for studying mutations in recombinant Struthio camelus MT-ND4L?

To effectively study mutations in recombinant MT-ND4L:

  • Site-directed mutagenesis optimization:

    • Use specialized strategies for GC-rich mitochondrial DNA templates

    • Consider whole-gene synthesis for multiple mutations

    • Verify constructs by complete sequencing before expression

  • Functional impact assessment:

    • Measure electron transfer rates in reconstituted systems

    • Assess superoxide production using specific fluorescent probes

    • Determine impact on proton pumping efficiency

    • Evaluate complex assembly using blue native PAGE

  • Structural stability analysis:

    • Perform thermal shift assays with membrane protein adaptations

    • Use circular dichroism to assess secondary structure changes

    • Apply hydrogen-deuterium exchange mass spectrometry to detect conformational alterations

When investigating MT-ND4L mutations, it's important to consider the potential impact on its interaction with MT-ND4, given their gene overlap and potential functional coordination. Mutations in human MT-ND4L have been associated with Leber's Hereditary Optic Neuropathy, suggesting critical functional roles that may be conserved in the ostrich ortholog .

How can researchers effectively isolate and characterize the native MT-ND4L protein from Struthio camelus mitochondria for comparison studies?

Isolating native MT-ND4L from ostrich mitochondria requires specialized techniques:

  • Tissue selection and mitochondrial isolation:

    • Flight muscles provide highest mitochondrial yield

    • Use sucrose gradient centrifugation for mitochondrial purification

    • Verify mitochondrial integrity using respiratory control ratio measurements

  • Gentle solubilization protocol:

    • Use digitonin (0.5-1%) for initial membrane solubilization

    • Maintain physiological ionic strength to preserve protein-protein interactions

    • Include protease inhibitors specific for mitochondrial proteases

  • Complex I isolation:

    • Apply blue native electrophoresis for complex separation

    • Use immunocapture with Complex I-specific antibodies

    • Employ hydroxyapatite chromatography for complex enrichment

  • Subunit separation:

    • Apply reversed-phase HPLC with specialized columns for hydrophobic proteins

    • Use organic solvent gradients optimized for membrane protein separation

    • Confirm identity by mass spectrometry and western blotting

This native protein can then serve as a critical reference standard for assessing the structural integrity and functional properties of the recombinant version, helping to validate experimental findings and identify any artifacts introduced during recombinant production .

What biophysical techniques provide the most reliable structural information for recombinant Struthio camelus MT-ND4L?

For optimal structural characterization of recombinant MT-ND4L:

TechniqueInformation ProvidedLimitationsSample Requirements
Cryo-electron microscopyNear-atomic resolution, context in Complex IRequires stable, homogeneous samples3-5 mg highly pure protein
Solid-state NMRAtomic-level structure in membrane environmentResolution limitations for complete structure5-10 mg isotope-labeled protein
X-ray crystallographyHigh-resolution structure when crystals obtainedCrystallization of membrane proteins challenging10+ mg highly pure, homogeneous protein
Hydrogen-deuterium exchange MSDynamic structural information, conformational changesIndirect structural inference1-2 mg protein, no isotope labeling required
FTIR spectroscopySecondary structure content in native environmentLimited resolution, ensemble measurements0.1-0.5 mg protein

When studying MT-ND4L structure, researchers should consider its native context within Complex I, where it forms part of the hydrophobic core of the transmembrane domain. The structural arrangement must accommodate the functional requirements of proton pumping and electron transport within the mitochondrial inner membrane .

What quality control parameters should be monitored when working with recombinant Struthio camelus MT-ND4L?

Rigorous quality control for recombinant MT-ND4L should include:

  • Protein purity assessment:

    • SDS-PAGE with specialized staining for hydrophobic proteins

    • Mass spectrometry to confirm molecular weight and detect modifications

    • Reversed-phase HPLC to evaluate homogeneity

  • Structural integrity verification:

    • Circular dichroism to confirm secondary structure composition

    • Tryptophan fluorescence to assess tertiary fold integrity

    • Thermal stability analysis to determine melting temperature

  • Functional validation:

    • NADH:ubiquinone oxidoreductase activity in reconstituted systems

    • Assembly competence with other Complex I subunits

    • Proton pumping capacity in proteoliposomes

  • Storage stability monitoring:

    • Time-course activity measurements under various storage conditions

    • Freeze-thaw stability assessment

    • Aggregation monitoring by dynamic light scattering

Given the hydrophobic nature of MT-ND4L, special attention must be paid to detergent concentration, which must remain above critical micelle concentration to prevent aggregation. Additionally, monitoring the oxidation state of the protein is important, as mitochondrial proteins are particularly susceptible to oxidative damage that can affect functional studies .

How can recombinant Struthio camelus MT-ND4L be utilized in comparative mitochondrial function studies?

Recombinant ostrich MT-ND4L offers valuable research applications in comparative studies:

  • Cross-species functional conservation analysis:

    • Create chimeric Complex I with subunits from different species

    • Measure electron transfer efficiency across evolutionary diverse components

    • Identify species-specific adaptations in mitochondrial energy production

  • Temperature adaptation studies:

    • Compare function of MT-ND4L from ectothermic versus endothermic species

    • Measure activity across temperature ranges relevant to different species

    • Identify structural features conferring thermal stability

  • Metabolic rate correlation studies:

    • Compare MT-ND4L function from species with divergent metabolic rates

    • Correlate Complex I efficiency with body mass and metabolic intensity

    • Identify adaptations in high-performance species (birds, bats)

Mitochondrial genome studies have already been used to establish phylogenetic relationships between species, including Struthio camelus. These comparative approaches can be extended to functional studies of individual proteins like MT-ND4L to understand how evolutionary adaptations manifest at the molecular level .

What are the most promising approaches for overcoming the hydrophobicity challenges when working with recombinant Struthio camelus MT-ND4L?

Innovative strategies to address MT-ND4L's hydrophobicity include:

  • Advanced membrane-mimetic systems:

    • Nanodiscs with tunable lipid composition

    • Amphipathic polymers (amphipols) for detergent-free stabilization

    • Styrene-maleic acid lipid particles (SMALPs) for native lipid environment preservation

  • Fusion partner optimization:

    • Engineer soluble fusion partners that can be cleaved after folding

    • Utilize membrane protein-specific carriers (Mistic, GlpF)

    • Develop ostrich-specific optimized fusion constructs

  • Co-expression strategies:

    • Simultaneous expression with interacting partners

    • Inclusion of specific lipids in expression systems

    • Co-expression with mitochondrial chaperones

  • Cell-free expression with specialized additives:

    • Direct incorporation into liposomes during synthesis

    • Use of specialized detergent mixtures optimized for membrane proteins

    • Addition of membrane fragments as scaffolds during expression

These approaches must be carefully optimized for the specific properties of Struthio camelus MT-ND4L, taking into account its unique amino acid composition and structural requirements within Complex I .

How might research on Struthio camelus MT-ND4L contribute to understanding mitochondrial disease mechanisms?

Research on ostrich MT-ND4L can provide unique insights into mitochondrial diseases:

  • Comparative pathogenic mutation analysis:

    • Identify conservation of residues involved in human mitochondrial diseases

    • Reconstruct the functional impact of disease-associated mutations

    • Develop evolutionary context for interpreting clinical variants

  • Species-specific resistance mechanisms:

    • Investigate naturally occurring variations that confer resistance to dysfunction

    • Identify compensatory mechanisms that preserve function despite potentially deleterious mutations

    • Explore the structural basis for differential sensitivity to inhibitors and toxins

  • Aging and oxidative stress models:

    • Compare long-lived avian MT-ND4L function with mammalian orthologs

    • Investigate resistance to oxidative damage in different species

    • Correlate structural features with species lifespan

Variants in human MT-ND4L have been associated with Leber's Hereditary Optic Neuropathy (LHON), indicating the critical functional importance of this small protein. Comparative studies using the ostrich ortholog could reveal evolutionary adaptations that affect susceptibility to mitochondrial dysfunction .

What are the future directions for integrating computational and experimental approaches in Struthio camelus MT-ND4L research?

Emerging integrative approaches for MT-ND4L research include:

  • AI-driven structure prediction validation:

    • Use AlphaFold2 and RoseTTAFold predictions as starting points for experimental validation

    • Apply molecular dynamics simulations in membrane environments

    • Develop species-specific force fields for mitochondrial membrane proteins

  • Systems biology integration:

    • Model MT-ND4L function within whole-mitochondrial metabolic networks

    • Simulate electron flow and proton pumping with quantum mechanical approaches

    • Integrate transcriptomic and proteomic data to understand expression regulation

  • Evolutionary sequence-structure-function relationships:

    • Apply deep mutational scanning to map sequence-function relationships

    • Correlate evolutionary rate heterogeneity with structural constraints

    • Identify co-evolving residue networks between interacting subunits

  • Multi-scale modeling approaches:

    • Connect atomic-level simulations to organelle-level function

    • Model reactive oxygen species generation in different structural contexts

    • Simulate assembly pathways of Complex I incorporating MT-ND4L

These integrative approaches will benefit from the unusual genetic features observed in MT-ND4L, such as the 7-nucleotide overlap with MT-ND4, which provides opportunities to understand coordinated expression and assembly of adjacent components in the complex .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.