Recombinant Subterranean clover stunt virus Putative movement protein (DNA-M)

Shipped with Ice Packs
In Stock

Description

Introduction to Subterranean Clover Stunt Virus

Subterranean clover stunt virus (SCSV) is the type species of the genus Nanovirus within the family Nanoviridae . It was the first single-stranded DNA plant virus with a multipartite genome to have its genomic DNA sequences determined . SCSV predominantly infects leguminous plants, causing characteristic stunting symptoms that can significantly impact agricultural productivity . The virus is naturally transmitted by aphids and has been primarily studied in Australia where it affects important forage crops .

The name "nanovirus" derives from the Greek word "nanos" meaning "small," which aptly describes both the diminutive size of the viral particles (18-19 nm in diameter) and the relatively small genome segments (approximately 1 kb each) . These physical characteristics, combined with the stunting effects typically observed in infected plants, provide the etymological basis for the virus classification.

Genomic Organization of SCSV

Each genomic component consists of a circular, single-stranded DNA molecule of approximately 1 kb in size, and encodes a single protein . The eight genomic components of SCSV are designated according to their encoded proteins:

DNA ComponentSize (nt)Encoded ProteinFunction
DNA-R~1000Master replication initiator protein (M-Rep)Initiates replication of all genomic DNAs
DNA-S~1000Structural (capsid) protein (CP)Forms viral capsid
DNA-C~1000Cell cycle link protein (Clink)Modulates host cell cycle
DNA-M1001Movement protein (MP)Facilitates cell-to-cell movement
DNA-N~1000Nuclear shuttle protein (NSP)Shuttles viral DNA
DNA-U1~1000Unknown functionSymptom determinant
DNA-U2~1000Unknown functionSymptom determinant
DNA-U4~1000Unknown functionDispensable for symptoms

Additionally, SCSV is associated with alpha-satellites, which are satellite-like DNA molecules that encode replication-associated proteins but are not essential for viral infection .

The DNA-M Component and Movement Protein

The DNA-M component of SCSV encodes the putative movement protein (MP), which plays a critical role in viral cell-to-cell movement . This protein facilitates the transport of viral genetic material between plant cells through plasmodesmata, specialized channels that traverse plant cell walls .

The movement protein has structural similarity with movement proteins of geminiviruses, suggesting a common evolutionary ancestry and similar functional mechanisms . Research on nanoviruses has demonstrated that the MP localizes in cellular membranes when expressed in plant tissues, providing evidence for its role in the symplastic movement of the virus through plasmodesmata .

The compatibility between the movement protein (encoded by DNA-M) and the capsid protein (encoded by DNA-S) is thought to impose constraints on the success of reassortments among nanoviruses, highlighting the critical nature of these proteins in the viral infection cycle .

Expression and Purification

The recombinant SCSV putative movement protein is typically expressed in bacterial expression systems, most commonly Escherichia coli . This approach allows for efficient production of the protein for research and commercial purposes.

The purification process generally involves the following steps:

  1. Expression in E. coli with an N-terminal His-tag

  2. Cell lysis and protein extraction

  3. Affinity chromatography using the His-tag

  4. Quality assessment by SDS-PAGE to ensure >90% purity

  5. Lyophilization for long-term storage

The recombinant protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For reconstitution, it is recommended to briefly centrifuge the vial before opening and then reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . To enhance stability during storage, addition of 5-50% glycerol (final concentration) is recommended, followed by aliquoting for long-term storage at -20°C/-80°C .

Proper storage procedures are critical for maintaining protein activity. Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week .

Applications and Research

The recombinant SCSV putative movement protein has several applications in research settings:

Viral Movement Studies

The protein serves as a model for understanding viral movement mechanisms in plant systems. Studies have shown that nanovirus MPs, including that of SCSV, localize to cellular membranes when expressed in plant cells, suggesting movement via the symplastic route through plasmodesmata .

Protein-Protein Interaction Studies

Research has investigated interactions between the movement protein and other viral components, particularly the capsid protein. These interactions are critical for viral assembly and movement, and understanding them can provide insights into viral pathogenesis mechanisms .

Immunological Applications

Recombinant viral proteins, including the SCSV movement protein, can be used in the development of antibodies for virus detection and in ELISA-based diagnostic systems .

Evolutionary Studies

Comparative analyses of movement proteins from different nanoviruses, including SCSV, provide insights into viral evolution. These studies have revealed that nanoviruses and geminiviruses likely share a common ancestor, with the ancestral virus being more similar to nanoviruses in particle structure and genome organization .

Recombination Events in DNA-M

Research has identified significant recombination events in the DNA-M component of SCSV. Deep sequencing analysis of SCSV isolates has revealed the presence of recombinant DNA-M molecules . For example, in the SCSV isolate [AU;3771A], researchers identified two variants of DNA-M:

  1. DNA-M.1: The non-recombinant form

  2. DNA-M.2: A recombinant form showing recombination with DNA-R at nucleotide positions 927 to 958

These recombinant forms were found to coexist in approximately equal abundance within the same isolate . This finding highlights the dynamic nature of the SCSV genome and the importance of recombination in its evolution.

Intra- and inter-genome recombination appears to be common among single-stranded DNA viruses and has been identified in all nanovirid genomes analyzed for recombination, including SCSV . These recombination events can lead to genetic diversity and potentially impact viral fitness and host range.

Future Research Directions

Several promising areas for future research on the SCSV putative movement protein include:

Host-Virus Interactions

Investigation of how the movement protein interacts with host cellular components, particularly plasmodesmata-associated proteins, could enhance our understanding of viral movement mechanisms and potentially identify targets for intervention.

Recombination Dynamics

Further research on the frequency and functional consequences of recombination events in DNA-M could provide insights into viral evolution and adaptation.

Antiviral Strategies

Understanding the critical role of the movement protein in viral infection cycles could lead to the development of targeted antiviral strategies for agricultural applications.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
DNA-M; C1; Putative movement protein; MP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Subterranean clover stunt virus (strain F) (SCSV)
Target Names
DNA-M
Target Protein Sequence
MDSGDGYNTYSYEEGAGDAKKEVLYKIGIIMLCIVGIVVLWVLIILCCAVPRYAKSTMDA WLSSSSIMKRKMASRITGTPFEETGPHRERRWAERRTEATNQNNNDNVNRFS
Uniprot No.

Target Background

Function
This protein may facilitate the direct transport of the viral genome to neighboring plant cells through plasmodesmata, without the need for budding. This movement protein allows for efficient cell-to-cell propagation, bypassing the host cell wall barrier.
Protein Families
Nanovirus movement protein family
Subcellular Location
Host cell membrane; Single-pass membrane protein.

Q&A

What is Subterranean clover stunt virus and its genome organization?

Subterranean clover stunt virus (SCSV) is the type species of the genus Nanovirus in the family Nanoviridae. It was the first single-stranded DNA plant virus with a multipartite genome to have its genomic DNA sequences determined . All nanoviruses, including SCSV, have eight characteristic single-stranded DNA (ssDNA) genome components of approximately 1 kb in size. These components are named according to the functions of their encoded proteins: DNA-R (master replication initiator protein), DNA-S (structural/capsid protein), DNA-C (cell cycle link protein), DNA-M (movement protein), DNA-N (nuclear shuttle protein), and three components (DNA-U1, DNA-U2, and DNA-U4) with proteins of unknown function . Earlier research incorrectly reported that SCSV only possessed six genomic components, missing DNA-U2 and DNA-U4, but recent analyses have confirmed the presence of all eight components in field isolates .

What is the function of the SCSV movement protein encoded by DNA-M?

The movement protein (MP) encoded by DNA-M facilitates the cell-to-cell movement of the virus within infected plants. The functional identity of the SCSV MP was inferred from its similarities with corresponding movement proteins found in geminiviruses . While the precise mechanism of action for the SCSV MP has not been fully characterized, movement proteins typically modify plasmodesmata (intercellular channels) to allow viral genome transit between cells. This function is crucial for establishing systemic infection within the host plant. Unlike the nuclear shuttle protein (NSP), which is essential for aphid transmission but dispensable for symptom development in some nanoviruses, the movement protein is required for the virus to spread throughout plant tissues .

How is SCSV DNA-M typically detected in research settings?

Detection of SCSV DNA-M in research settings typically employs component-specific PCR amplification. Researchers design specific back-to-back primers based on known SCSV DNA-M sequences to amplify full-length components. For example, when analyzing SCSV isolates, researchers designed specific primers for all components, including DNA-M, based on sequences of reference isolates like SCSV-[AU;F] . The amplification typically follows a rolling circle amplification (RC-amplification) step to increase the amount of circular viral DNA. For comprehensive detection, high-throughput sequencing technologies are now also employed, which can simultaneously identify all viral components present in a sample and enable detection of variant forms, such as recombinant versions of DNA-M .

What evidence exists for recombination in SCSV DNA-M?

Deep sequencing analysis of SCSV isolates has revealed clear evidence of recombination in the DNA-M component. In the isolate SCSV-[AU;3771A] from pea, researchers identified a recombinant DNA-M.2 variant showing a recombination event with DNA-R at nucleotides 927 to 958 . This recombinant co-existed with the non-recombinant DNA-M.1 in approximately equal abundance, indicating both forms were viable and maintained during viral replication . Such recombination events are not limited to the DNA-M component; various recombinant forms have been detected across different SCSV genome components, suggesting that recombination is a common evolutionary mechanism in nanoviruses. This intra- and inter-genome recombination appears to be widespread among ssDNA viruses generally and has been documented in all nanovirus genomes analyzed for recombination .

How do researchers differentiate between original and recombinant DNA-M components?

Differentiating between original and recombinant DNA-M components requires sequence analysis following PCR amplification or high-throughput sequencing. The process typically involves:

  • Full genome component sequencing using component-specific primers

  • Sequence alignment and comparison with reference sequences

  • Recombination detection analysis using specialized software tools

  • Identification of breakpoints where sequence identity shifts from one parent sequence to another

For the SCSV DNA-M.2 recombinant, researchers identified a specific region (nucleotides 927-958) where the sequence matched DNA-R rather than the expected DNA-M sequence pattern . This was confirmed through comparative analysis with the non-recombinant DNA-M.1 from the same isolate. The co-existence of both forms in a single isolate allows for direct comparison and verification of the recombination event. Visual representation of such recombination events is often presented in the form of similarity plots or schematic diagrams showing the recombination breakpoints (Supplementary Figure S4 in the research) .

What is the relative abundance of recombinant versus non-recombinant DNA-M in SCSV infections?

In the SCSV isolate [AU;3771A], deep sequencing revealed that the recombinant DNA-M.2 and the non-recombinant DNA-M.1 were present in approximately equal abundance . This equal representation suggests that both forms are functionally viable and stable within the viral population. Quantitative data on the relative abundance of SCSV genome components are typically presented in supplementary materials (Supplementary Table S2 in the research) . This equal abundance pattern was also observed with other recombinant components in SCSV, such as with DNA-U4.1 and the recombinant DNA-U4.2 in isolate SCSV-[AU;2534B]. The maintenance of both original and recombinant forms suggests that recombination may provide evolutionary advantages under certain conditions, potentially contributing to viral adaptation to different hosts or environmental pressures .

What methodologies are most effective for studying recombination events in SCSV DNA-M?

Studying recombination events in SCSV DNA-M requires a multi-faceted approach combining molecular techniques and bioinformatics analysis:

  • Rolling Circle Amplification (RCA): This technique preferentially amplifies circular DNA molecules and is particularly useful for nanovirus genomes. It provides an unbiased amplification of all viral components prior to specific PCR targeting or sequencing .

  • Component-Specific PCR: Using back-to-back primers designed from conserved regions of DNA-M to amplify full-length components. For detecting recombination events, primers from different genomic regions may yield unexpected product sizes that suggest recombination .

  • High-Throughput Sequencing (HTS): This approach allows for comprehensive detection of all viral DNAs in a sample, including minor variants and recombinants. HTS was crucial in identifying the DNA-M.2 recombinant in SCSV-[AU;3771A] .

  • Bioinformatic Analysis Tools:

    • Sequence alignment software to compare variants

    • Recombination detection algorithms (e.g., RDP4)

    • Visualization tools to represent recombination breakpoints

    • Phylogenetic analysis to establish relationships between recombinants and parent sequences

  • Cloning and Verification: After identification of potential recombinants, cloning and Sanger sequencing of individual DNA molecules confirms the recombination events and rules out sequencing artifacts .

The most effective approach combines these techniques, starting with RCA to capture all circular viral DNAs, followed by HTS for comprehensive identification, and finally biological validation through cloning or functional studies of the recombinant proteins.

What are the implications of recombination in SCSV DNA-M for nanovirus evolution?

Recombination in SCSV DNA-M has several important implications for nanovirus evolution:

  • Genetic Diversity Generation: Recombination provides a mechanism for rapid generation of genetic diversity beyond what accumulates through mutations alone. The identification of DNA-M.2 recombinants co-existing with DNA-M.1 demonstrates how recombination enhances viral diversity .

  • Adaptive Potential: Recombination may facilitate adaptation to new hosts or changing environments. The frequent recombination observed in SCSV genomes suggests this mechanism may be particularly important for nanoviruses .

  • Genome Component Exchange: The multipartite nature of nanovirus genomes may facilitate recombination between different components. The recombination event between DNA-M and DNA-R demonstrates how genetic material can be exchanged between functionally distinct components .

  • Evolution Rate: Studies comparing sequences of SCSV-[AU;F] and SCSV-[AU;F*] showed a substitution rate of approximately 1.1 × 10^(-3) per site per year, which is consistent with rates observed in other nanoviruses (e.g., FBNSV at 1.8 × 10^(-3)) . Recombination events may accelerate this evolutionary process.

  • Functional Adaptation: Recombination that preserves protein function while altering non-coding regions (as seen in some SCSV components) suggests selection pressure maintains functional integrity while allowing genomic flexibility .

Understanding these recombination patterns is crucial for predicting the evolutionary trajectory of nanoviruses and developing effective control strategies.

How might host factors influence recombination frequency in SCSV DNA-M?

Host factors likely play significant roles in influencing recombination frequency in SCSV DNA-M, though this remains an area requiring further research. Several observations provide insights:

  • Host-Specific Genome Formula: Research on other nanoviruses, specifically FBNSV, has shown that the relative abundance of individual genome components varies according to a "host-specific genome formula" between different host plants (e.g., between Vicia faba and Medicago truncatula) . This suggests host factors influence viral component replication and potentially recombination rates.

  • Component Loss in Laboratory Maintenance: The loss of certain SCSV genome components during prolonged laboratory maintenance through aphid transmission suggests host-vector-virus interactions can affect genome stability . In SCSV-[AU;F*] maintained in subterranean clover, DNA-U4 was lost, while DNA-M remained present, suggesting differential selection pressure on various components depending on the host environment.

  • Field vs. Laboratory Isolates: Field isolates of SCSV from subterranean clover maintained all eight genome components, whereas laboratory-maintained isolates lost components, suggesting natural host environments may better support genome integrity and recombination dynamics .

  • Host Defense Responses: Host plants employ various defense mechanisms against viral infections, including RNA silencing pathways. These defenses may exert selective pressure, potentially influencing recombination rates as a viral counter-adaptation mechanism.

Researchers investigating host influence on SCSV DNA-M recombination should consider comparative studies across multiple host species, analyzing recombination frequencies and patterns to identify host-specific factors that modulate genetic exchange.

What experimental designs best capture the dynamics of DNA-M recombination in SCSV populations?

To effectively capture the dynamics of DNA-M recombination in SCSV populations, researchers should implement the following experimental design elements:

  • Temporal Sampling Framework:

    • Regular sampling intervals from the same infected plants over time

    • Analysis of isolates from different years and geographical locations

    • Comparison of laboratory-maintained versus field isolates

  • Multiple Host Systems:

    • Parallel infections in different host species (e.g., subterranean clover, pea, faba bean)

    • Analysis of how host switching affects recombination patterns

    • Inclusion of potential reservoir hosts like woolly burr medic (Medicago minima)

  • Sequencing Depth Considerations:

    • High-throughput sequencing with sufficient depth to detect low-frequency recombinants

    • Multiple sequencing technologies to minimize platform-specific biases

    • Targeted deep sequencing of specific genome regions prone to recombination

  • Recombination Validation:

    • PCR amplification with primers spanning potential recombination junctions

    • Cloning and Sanger sequencing of individual molecules

    • Biological assays to assess functionality of recombinant proteins

  • Quantitative Analysis:

    • Real-time PCR to quantify relative abundance of recombinant versus non-recombinant forms

    • Statistical modeling of recombination rates under different conditions

    • Correlation analysis between recombination frequency and biological parameters

How does the recombination in DNA-M compare to recombination patterns in other SCSV genome components?

The recombination patterns in SCSV DNA-M show both similarities and differences compared to other SCSV genome components:

  • Recombination Frequency:

    • Recombination appears to be a common phenomenon across multiple SCSV components, including DNA-M, DNA-U4, and DNA-N

    • No evidence suggests DNA-M has significantly higher or lower recombination rates compared to other components based on current data

  • Recombination Partners:

    • DNA-M.2 showed recombination with DNA-R at nucleotides 927-958

    • DNA-U4.2 (recombinant) contained sequences derived from DNA-C (or DNA-M or DNA-U1)

    • DNA-N in SCSV-[AU;F*] had an 87-nucleotide recombinant sequence derived from DNA-S

    • This suggests flexibility in recombination partners across the genome

  • Breakpoint Locations:

    • Recombination in DNA-M occurred near the 3' end (nt 927-958)

    • In DNA-N, recombination occurred in the non-coding region, preserving protein function

    • DNA-U4.2 recombination involved nucleotides 934-948

    • This indicates potential hotspots or preferences for recombination locations, often preserving coding sequences

  • Maintenance of Recombinants:

    • Both DNA-M.1 (non-recombinant) and DNA-M.2 (recombinant) co-existed in approximately equal abundance

    • Similarly, DNA-U4.1 and DNA-U4.2 (recombinant) were equally abundant

    • This pattern of co-existence appears consistent across different SCSV components

What technological advancements would enhance our ability to study SCSV DNA-M recombination events?

Several technological advancements could significantly enhance our ability to study SCSV DNA-M recombination events:

  • Long-Read Sequencing Technologies:

    • Technologies like Oxford Nanopore or PacBio sequencing would allow complete genome components to be sequenced in a single read

    • This would improve detection of complex recombination events spanning multiple regions and eliminate assembly artifacts

    • Single-molecule sequencing would provide definitive evidence of recombination within individual DNA molecules

  • Advanced Bioinformatics Tools:

    • Development of specialized algorithms for detecting recombination in circular DNA viruses

    • Machine learning approaches to predict recombination hotspots based on sequence motifs or structural features

    • Improved visualization tools for representing complex recombination networks

  • In Situ Molecular Imaging:

    • Technologies to visualize recombination events in real-time within plant cells

    • Fluorescent tagging of different genome components to track co-localization and potential recombination sites

    • Super-resolution microscopy to observe virus replication complexes where recombination likely occurs

  • Synthetic Biology Approaches:

    • CRISPR-Cas systems adapted for engineering nanovirus genomes

    • Artificial genome component construction with molecular barcodes to track recombination

    • Development of reverse genetics systems specific for multipartite ssDNA viruses

  • High-Throughput Functional Assays:

    • Rapid systems to test the functionality of recombinant movement proteins

    • Cell-based assays to assess protein-protein interactions affected by recombination

    • Techniques to measure the effect of recombination on virus transmission efficiency

These technological advancements would provide deeper insights into the mechanisms, frequency, and biological significance of recombination events in SCSV DNA-M and other genome components .

What are the most pressing unanswered questions regarding SCSV DNA-M recombination?

Despite recent advances in understanding SCSV genome organization and recombination patterns, several critical questions regarding DNA-M recombination remain unanswered:

  • Functional Consequences: How does recombination in DNA-M affect the movement protein function, viral spread within plants, or transmission efficiency? Studies comparing the functionality of DNA-M.1 and DNA-M.2 encoded proteins would be invaluable .

  • Recombination Mechanisms: What molecular mechanisms facilitate recombination in SCSV DNA-M? Are there specific sequence motifs or secondary structures that promote recombination events?

  • Selection Pressures: What evolutionary advantages might recombination in DNA-M confer? Does the coexistence of DNA-M.1 and DNA-M.2 represent differential adaptation to specific conditions or hosts?

  • Host Range Impact: How does DNA-M recombination influence SCSV host range or virulence? Comparative studies in different host plants could reveal whether recombinant variants show host-specific advantages .

  • Temporal Dynamics: How stable are DNA-M recombinants over time? Do proportions of recombinant versus non-recombinant forms fluctuate seasonally or during disease progression?

  • Interspecies Recombination: Can SCSV DNA-M recombine with related components from other nanoviruses during mixed infections? Such events could significantly impact virus evolution and emergence.

Addressing these questions will require integrated approaches combining molecular virology, evolutionary analysis, and functional genomics to fully understand the biological significance of DNA-M recombination in SCSV .

How might SCSV DNA-M research inform broader understanding of multipartite virus evolution?

Research on SCSV DNA-M recombination has significant implications for understanding the evolution of multipartite viruses more broadly:

  • Genome Formula Concept: The maintenance of multiple genome components in specific ratios (the "genome formula") has been documented in nanoviruses . Understanding how recombination in DNA-M affects this balance could provide insights into the evolutionary constraints on multipartite genomes.

  • Component Exchange Mechanisms: The recombination between different SCSV components (e.g., between DNA-M and DNA-R) demonstrates mechanisms for genetic material exchange within a segmented genome system . This may explain how new functional components evolve in multipartite viruses.

  • Adaptive Flexibility: The coexistence of original and recombinant forms of DNA-M suggests multipartite viruses may maintain genetic diversity through recombination while preserving core functions . This "modular evolution" strategy may be a key advantage of genome segmentation.

  • Host Adaptation Model: Research showing different recombination patterns across host species provides a model for studying how multipartite viruses adapt to different hosts through component-specific changes rather than whole-genome adaptations .

  • Genome Component Loss and Gain: The documentation of component loss in laboratory maintenance (e.g., DNA-U4) versus field isolates offers insights into the minimal essential genome of multipartite viruses and the selective pressures maintaining "accessory" components .

SCSV DNA-M research thus serves as a valuable model system for understanding fundamental evolutionary processes in multipartite viruses, with potential applications to understanding other segmented virus families .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.