Recombinant Subtilin transport ATP-binding protein SpaT (spaT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a preferred tag type, please specify it to us, and we will prioritize its implementation.
Synonyms
spaT; spaB; spaY; Subtilin transport ATP-binding protein SpaT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-614
Protein Length
full length protein
Species
Bacillus subtilis
Target Names
spaT
Target Protein Sequence
MEVKEQLKLKELLFIMKQMPKTFKLIFTLERSLFLKLIRFSIITGILPIVSLYISQELIN SLVTIRKEVSIVITIFLTYLGVSFFSELISQISEFYNGKFQLNIGYKLNYKVMKKSSNLA LKDFENPEIYDKLERVTKEISYKPYQIIQAIITMTTSFVTLLSSIAFLMSWNPKVSLLLL VIPVISLFYFLKIGQEEFFIHWKRAGKERKSWYISYILTHDFSFKELKLYNLKDYLLNKY WDIKKSFIEQDTKILRKKTLLNLIYEIAVQLVGAVIIFIAIMSAFAGKIMVGNVMSYIRS VSLVQNHSQSIMTSIYSIYNSNLYMNQLYEFLELKEEKSQGHKKPIVEPIHSVVFQNVSF IYPNQGEQTLKHINVSLHKGERVAIVGPNGSGKKTFIKLLTGLYEVHEGDILINGINIKE LDMDSYMNQIAALFQDFMKYEMTLKENIGFGQIDKLHQTNKMHEVLDIVRADFLKSHSSY QFDTQLGLWFDEGRQLSGGQWQKIALARAYFREASLYILDEPSSALDPIAEKETFDTFFS LSKDKIGIFISHRLVAAKLADRIIVMDKGEIVGIGTHEELLKTCPLYKKMDESENYMNPL EEEGSKWKEALYQG
Uniprot No.

Target Background

Function
SpaT, the Subtilin transport ATP-binding protein, is likely involved in the export process of the lantibiotic subtilin.
Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Subtilin transport ATP-binding protein SpaT and what is its role in lanthipeptide biosynthesis?

SpaT is an ATP-binding cassette (ABC) transporter protein that plays a crucial role in the biosynthetic pathway of subtilin, a type A(I) lantibiotic produced by Bacillus subtilis. As a dedicated transporter, SpaT is responsible for the export of fully modified subtilin precursor peptides across the cytoplasmic membrane.

In the lanthipeptide biosynthetic pathway, SpaT functions as part of the multimeric lanthionine synthetase complex, which is crucial for the efficient biosynthesis of these antimicrobial peptides. The association of SpaT with modification enzymes (like SpaB and SpaC in the native subtilin system) forms a functional complex that coordinates the modification and transport processes .

SpaT demonstrates remarkable cross-functionality, as evidenced by its ability to efficiently transport heterologous substrates like nisin precursors when expressed in Lactococcus lactis. This cross-functionality has been extensively studied due to the high similarity between the nisin and subtilin systems .

How does SpaT interact with modification enzymes in the lanthipeptide biosynthetic pathway?

SpaT interacts with lanthipeptide modification enzymes to form a functional biosynthetic complex. Research indicates that in Lactococcus lactis, SpaT can be recruited to specific cellular locations by nisin modification enzymes NisB and NisC, forming a promiscuous NisBC-SpaT complex .

This interaction appears to be essential for the coordinated modification and transport of lanthipeptide precursors. Experimental evidence shows that both NisB and NisC are required for the recruitment process of heterologous transporters like SpaT, as individual enzymes are unable to attract the transporter to the export site .

The assembly of this complex typically occurs at specific cellular locations, such as the old cell poles in coccoid cells. This localized assembly is crucial for the efficient production and secretion of fully modified lanthipeptide precursors .

What experimental evidence demonstrates the transport activity of SpaT in heterologous systems?

Experimental evidence for SpaT transport activity in heterologous systems has been demonstrated through genetic engineering and analytical techniques. In one key study, researchers deleted the native nisin transporter gene (nisT) from the wild-type operon nisABTC and inserted the spaT gene downstream of the resulting operon nisABC, creating a new gene cluster (nisABC-spaT) regulated by the nisin-inducible promoter .

The transport activity was assessed through:

  • SDS-PAGE analysis of TCA-precipitated culture supernatants, which showed that nisin precursor was exported by SpaT at levels comparable to NisT-mediated secretion

  • Antimicrobial activity assays confirming identical activities between peptides secreted by both transporters

  • MALDI-TOF MS analysis demonstrating that the secreted peptides had been dehydrated eight times, indicating complete modification prior to transport

These findings conclusively demonstrate that SpaT can efficiently transport heterologous substrates like the nisin precursor in L. lactis, but only after complete modification by the NisBC enzymes .

What techniques are most effective for studying the localization and assembly of SpaT with modification enzymes?

Several advanced microscopy and molecular biology techniques have proven effective for studying SpaT localization and its assembly with modification enzymes:

Fluorescence Microscopy Approaches:

  • Fluorescent protein fusions (e.g., GFP-SpaT) allow for real-time visualization of SpaT localization in living cells

  • Dual-color fluorescence microscopy with differently labeled proteins (e.g., SpaT-GFP and NisB-mCherry) enables the study of colocalization and interaction dynamics

  • Time-lapse microscopy facilitates observation of the temporal sequence of complex formation

Molecular Biology Techniques:

  • Gene deletion and complementation studies to assess the contribution of individual components to complex formation

  • Site-directed mutagenesis to identify crucial residues involved in protein-protein interactions

  • Co-immunoprecipitation and pull-down assays to verify physical interactions between SpaT and modification enzymes

Research has revealed that in B. subtilis, NisB and NisC assemble as a modification machinery at the cell poles and septum. When NisT is replaced by SpaT, the NisBC complex maintains its original localization, while SpaT is uniformly distributed in the cytoplasmic membrane, suggesting incomplete assembly of the NisBC-SpaT complex .

In contrast, in L. lactis, SpaT (initially distributed throughout the membrane) can be recruited to the old cell poles by NisBC, forming a functional heterologous complex. This recruitment requires both NisB and NisC, as individual enzymes cannot attract SpaT to the export site .

How can researchers effectively analyze cross-functionality between SpaT and heterologous modification enzymes?

Analyzing cross-functionality between SpaT and heterologous modification enzymes requires a multi-faceted experimental approach:

Gene Replacement and Complementation:

  • Systematic replacement of native transporter genes with spaT in heterologous systems

  • Construction of chimeric operons (e.g., nisABC-spaT) to assess compatibility

  • Individual replacement of modification enzymes (e.g., nisB with spaB) to determine specific interactions

Functional Assays:

  • Quantification of secreted peptide yield through SDS-PAGE and Western blotting

  • Assessment of antimicrobial activity using zone of inhibition assays

  • Analysis of peptide modifications using:

    • MALDI-TOF MS to determine dehydration status

    • CDAP coupling assays to detect free cysteine residues and infer cyclization

Data Table: Experimental Results from Cross-Functionality Studies

Enzyme CombinationSecretion EfficiencyAntimicrobial ActivityDehydration StatusCyclization Status
NisBC + NisT (control)HighDetected8 dehydrationsComplete
NisBC + SpaTHighDetected8 dehydrationsComplete
SpaB-NisC + SpaTSeverely decreasedNot detectedNo dehydrationNone
NisB-SpaC + SpaTDecreasedNot detected8 dehydrationsPartial (3 free cysteines)
No enzymes + SpaTLowNot detectedNo dehydrationNone

This systematic approach has revealed that while SpaT can efficiently transport nisin precursor modified by NisBC, the subtilin modification enzymes (SpaB and SpaC) cannot correctly modify the NisA peptide, likely due to failure to recognize the heterologous leader peptide .

What experimental designs are most appropriate for investigating SpaT function in different cellular contexts?

Investigating SpaT function across different cellular contexts requires careful selection of experimental designs. Both fully experimental and quasi-experimental approaches may be applicable:

Randomized Controlled Trials (RCTs):

  • Useful for directly comparing SpaT function under different controlled conditions

  • Can assess the effect of specific mutations or environmental factors on SpaT activity

  • Implementation-focused RCTs differ from traditional efficacy-oriented RCTs in that they focus on the strategies used to implement the research rather than just the outcomes

Optimization Trials:

  • Factorial designs allow simultaneous testing of multiple factors affecting SpaT function

  • Sequential, multiple-assignment randomized trials (SMART) can be used to determine optimal sequences of experimental interventions

  • Particularly useful for studying how SpaT assembly and function change in response to different cellular conditions over time

Quasi-Experimental Designs:

  • Pre-post designs with non-equivalent control groups can assess SpaT function before and after specific interventions

  • Interrupted time series (ITS) analyses are valuable for tracking changes in SpaT activity over time following experimental manipulation

  • Stepped wedge designs, where all experimental units eventually receive the intervention but in a staggered fashion, may be useful for studying SpaT in multiple strains or species

When selecting an experimental design, researchers should consider:

  • The specific research question about SpaT function

  • Practical constraints of the research setting

  • Need for internal validity versus external generalizability

  • Available resources and time constraints

How should researchers approach contradictory data regarding SpaT function and interactions?

Contradictory data is common in complex biological systems, and SpaT research is no exception. Researchers should approach such contradictions methodically:

Identification and Classification of Contradictions:

  • Distinguish between semantic inconsistencies and true biological contradictions

  • Categorize contradictions based on their nature (e.g., methodological differences, contextual factors, or genuine scientific disagreement)

Contextual Analysis:
Apparent contradictions often stem from unexpressed contextual factors, including:

  • Different experimental organisms (e.g., B. subtilis vs. L. lactis)

  • Varied expression systems or growth conditions

  • Differences in protein constructs or fusion partners

  • Temporal factors in protein complex assembly

For example, the interaction between SpaT and NisBC appears different in B. subtilis compared to L. lactis, with SpaT showing uniform membrane distribution in B. subtilis but polar recruitment in L. lactis .

Resolution Strategies:

  • Direct Experimental Comparison: Replicate contradictory studies under identical conditions

  • Meta-analysis: Systematically analyze existing data to identify patterns and sources of variability

  • Computational Modeling: Use knowledge graphs and natural language processing to detect and resolve contradictions in the literature

  • Collaborative Resolution: Engage multiple research groups to independently verify findings

The prevalence of apparent contradictions in literature-derived knowledge graphs has been estimated at approximately 2.6%. In most cases, these contradictions can be resolved by qualifying information such as the specific experimental system, species, or conditions being studied .

What biochemical assays are most informative for characterizing SpaT activity?

Characterizing SpaT activity requires a combination of biochemical assays focused on its ATP-binding and hydrolysis functions, as well as its peptide transport capabilities:

ATP Hydrolysis Assays:
While specific SpaT ATP hydrolysis data is limited in the provided search results, methods used for other ATP-binding proteins like RecN can be adapted:

  • Colorimetric assays measuring inorganic phosphate release

  • Coupled enzyme assays that link ATP hydrolysis to NADH oxidation

  • Radioactive assays using [γ-32P]ATP to track ATP hydrolysis rates

ATP hydrolysis assays should be performed both in the presence and absence of substrate peptides to determine substrate-dependent stimulation of ATPase activity. For instance, RecN shows an ~8-fold stimulation of ATPase activity in the presence of single-stranded DNA without secondary structure .

Transport Activity Assays:

  • In vivo secretion assays:

    • TCA precipitation of culture supernatants followed by SDS-PAGE analysis

    • Quantification of secreted peptide yield

    • Antimicrobial activity assays of secreted peptides

  • Analytical characterization of transported peptides:

    • MALDI-TOF MS to determine modification status

    • CDAP coupling assays to detect free cysteine residues

    • HPLC purification and characterization of secreted peptides

  • Nucleotide dependency testing:

    • Assessment of transport activity in the presence of different nucleotides (ATP, ADP, non-hydrolyzable analogues)

    • Determination of nucleotide concentration requirements for optimal activity

What approaches can be used to study SpaT structure-function relationships?

Understanding SpaT structure-function relationships requires integrating molecular biology, structural biology, and computational approaches:

Mutagenesis Approaches:

  • Site-directed mutagenesis of key residues in:

    • ATP-binding domains

    • Transmembrane domains involved in substrate recognition

    • Regions implicated in protein-protein interactions with modification enzymes

  • Domain swapping between SpaT and other transporters (e.g., NisT) to identify regions responsible for substrate specificity and protein interactions

  • Truncation analysis to determine minimal functional domains

Structural Analysis Techniques:

  • X-ray crystallography of soluble domains (e.g., ATP-binding domains)

  • Cryo-electron microscopy for full-length transporter structure determination

  • NMR spectroscopy for dynamic studies of specific domains

  • Molecular modeling and homology modeling based on related ABC transporters

Functional Correlation:
Following structural studies and mutagenesis, functional assays should be performed to correlate structural features with:

  • ATP binding and hydrolysis rates

  • Substrate recognition specificity

  • Interaction with modification enzymes

  • Cellular localization patterns

What are the key unanswered questions regarding SpaT function in lanthipeptide biosynthesis?

Despite significant advances in understanding SpaT function, several critical questions remain unanswered:

  • Molecular Mechanism of Substrate Recognition:

    • How does SpaT distinguish between modified and unmodified precursor peptides?

    • What structural features of the substrate determine transport efficiency?

    • Is there direct interaction between SpaT and the leader peptide or core peptide regions?

  • ATP Hydrolysis Coupling to Transport:

    • How is ATP hydrolysis coupled to peptide transport?

    • What conformational changes occur during the transport cycle?

    • What is the stoichiometry of ATP hydrolysis per peptide transported?

  • Complex Formation Dynamics:

    • What molecular interactions facilitate LanBTC complex formation?

    • How stable is the complex during the biosynthetic process?

    • What factors determine species-specific differences in complex assembly?

  • Regulatory Mechanisms:

    • How is SpaT expression regulated in native and heterologous hosts?

    • Are there feedback mechanisms between transport efficiency and peptide biosynthesis?

    • What cellular factors influence SpaT activity and localization?

How can systems biology approaches advance our understanding of SpaT in the context of lanthipeptide biosynthetic pathways?

Systems biology approaches offer powerful tools to advance our understanding of SpaT within the broader context of lanthipeptide biosynthesis:

Multi-omics Integration:

  • Transcriptomics: Analyze co-expression patterns of spaT with other biosynthetic genes across different conditions

  • Proteomics: Map the SpaT interactome to identify all protein-protein interactions

  • Metabolomics: Correlate SpaT activity with lanthipeptide production and cellular metabolic state

  • Fluxomics: Track the flow of energy (ATP) through the biosynthetic pathway

Network Analysis:

Mathematical Modeling:

  • Develop kinetic models of SpaT transport incorporating ATP hydrolysis

  • Create spatial models of LanBTC complex formation and localization

  • Simulate the effects of various mutations on pathway efficiency

Data Integration and Knowledge Management:

  • Develop specialized knowledge graphs for lanthipeptide biosynthesis

  • Implement computational tools to identify and resolve contradictions in the literature

  • Use natural language processing to extract relevant information from the rapidly expanding literature

By integrating these approaches, researchers can develop a more comprehensive understanding of how SpaT functions within the complex network of lanthipeptide biosynthesis, potentially enabling rational engineering of these pathways for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.