Recombinant Succinate dehydrogenase cytochrome b556 subunit (sdhC)

What is Succinate dehydrogenase cytochrome b556 subunit (sdhC) and what is its function?

Succinate dehydrogenase cytochrome b556 subunit (sdhC) is a critical component of the succinate dehydrogenase (SDH) complex, which plays an essential role in both the tricarboxylic acid (TCA) cycle and the electron transport chain. The SDH complex consists of four subunits (SDHA, SDHB, SDHC, and SDHD), with sdhC specifically serving as one of the membrane-anchoring components that helps transfer electrons during cellular respiration .

In its recombinant form, the full-length sdhC protein typically consists of 130 amino acid residues and contains a hydrophobic region that allows it to integrate into the inner mitochondrial membrane. The protein's amino acid sequence (e.g., from Paracoccus denitrificans) begins with MADVNRGNRPLSPHLQVYRLPLAAITSIMTRITGHALVAGIVLITWWLVAAVTSPGAFAC and continues with the remaining amino acid sequence that forms the complete functional protein .

How does sdhC integrate with other SDH subunits to form a functional complex?

The integration of sdhC with other SDH subunits involves specific protein-protein interactions that are essential for complex stability and function. sdhC, along with sdhD, forms the membrane-anchoring component of the complex, while SDHA and SDHB constitute the catalytic portion.

These subunits must assemble correctly for proper electron transfer from succinate to ubiquinone. In three-dimensional protein models, variations in sdhC can be mapped to understand how mutations might affect interactions with other subunits. Importantly, all SDH subunits are interdependent, and dysfunction in one component typically affects the stability of the entire complex, which is why negative SDHB immunohistochemical staining is indicative of deficiency in any of the SDH subunits, including sdhC .

What are the characteristic structural features of recombinant sdhC protein?

Recombinant sdhC protein typically contains several characteristic features:

The recombinant protein, when expressed in systems like E. coli, maintains its core structural elements but includes modifications such as affinity tags that facilitate purification and detection. The protein's solvent accessibility differs between the assembled SDH complex state and the individual subunit state, which is an important consideration when designing experiments to study protein-protein interactions or when developing antibodies against specific epitopes .

What are the optimal conditions for storing and handling recombinant sdhC protein?

For optimal storage and handling of recombinant sdhC protein, researchers should follow these evidence-based protocols:

• Initial Storage: Store lyophilized powder at -20°C to -80°C upon receipt.

• Reconstitution: Prior to opening, centrifuge the vial briefly to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

• Working Solution Preparation: Add glycerol to a final concentration of 5-50% (typically 50%) and aliquot for long-term storage.

• Working Aliquots: Store working aliquots at 4°C for up to one week.

• Long-term Storage: Keep at -20°C/-80°C, avoiding repeated freeze-thaw cycles which can compromise protein integrity.

• Buffer Conditions: Maintain in Tris/PBS-based buffer with 6% Trehalose, pH 8.0 .

These conditions help preserve the structural integrity and functional activity of the recombinant protein for research applications.

How can researchers efficiently detect and analyze sdhC mutations in clinical samples?

Efficient detection and analysis of sdhC mutations requires a multi-faceted approach:

• Whole Exome Sequencing (WES): This technique can reveal novel sdhC variants, including intronic mutations that might be missed during routine testing. WES has successfully identified previously undetected variants in families with SDH-deficient tumors .

• Transcriptome Analysis: Essential for detecting aberrant splicing events, which may result from intronic mutations. For example, an intronic variant in sdhC was found to cause aberrant splicing with retention of an intronic segment that introduced a premature stop codon .

• Computational Prediction Tools: Multiple computational tools can predict the functional impact of non-synonymous mutations:

  • Various predictors consistently indicate high probability of protein damage for most sdhC variants

  • Splicing site predictors such as "ASSP-Alternative Splicing Site Predictor" and "NetGene2 server" can assess the impact of noncoding mutations near exon-intron boundaries

• Protein Modeling: Mapping variations on protein structure models helps understand their potential impact on function. The human SDH model can be plotted with UCSF Chimera software, allowing calculation of distances between mutated positions and functional sites like the FAD binding site .

What methodologies are most effective for studying sdhC knockdown effects in cancer research?

Based on recent research findings, the following methodologies have proven effective for studying sdhC knockdown effects in cancer research:

• siRNA-Mediated Knockdown:

  • Effective for creating transient sdhC knockdown models

  • Transfection of cancer cell lines (e.g., HCT116 and SW480) with specific siRNAs targeting sdhC

  • Validation of knockdown efficiency through qRT-PCR and western blot analysis

• Stable Knockdown Models:

  • Creation of stable sdhC knockdown cell lines (e.g., HCT116-sh-SDHC) for in vivo experiments

  • Essential for long-term in vivo studies of metastasis and tumor progression

• Functional Assays:

  • Wound healing assays to assess migration capability

  • Transwell assays to evaluate invasion capacity

  • These assays have demonstrated that sdhC knockdown significantly increases the migratory and invasive abilities of colorectal cancer cells

• In Vivo Metastasis Models:

  • Splenic injection model: Injection of stable knockdown cells into the spleen of nude mice to study liver metastasis

  • Intravenous injection model: To evaluate lung metastasis

  • These models have shown increased metastatic nodule formation in sdhC knockdown conditions

• Metabolic Analysis:

  • Assessment of fatty acid metabolism pathways through Gene Set Enrichment Analysis

  • Measurement of fatty acid synthesis and oxidation rates

  • Evaluation of lipid accumulation in response to sdhC knockdown

How do various sdhC mutations affect protein function and cellular metabolism?

sdhC mutations can have diverse effects on protein function and cellular metabolism, with implications for both basic research and clinical applications:

• Structural Implications:
  Mutations in sdhC often occur distant from the protein's active site, suggesting that they may affect protein stability or interactions rather than directly altering catalytic activity. For instance, detailed protein mapping has shown that mutations can be found far from the FAD binding site, with specific distances calculable through molecular modeling techniques .

• Splicing Alterations:
  Some mutations, particularly intronic variants, can dramatically affect mRNA splicing. For example, the deletion c.457-3_457-1 delCAG located immediately upstream of exon 5 has been predicted by splicing site predictors to create an alternative splicing site. This leads to a frame shift and premature stop codon, effectively inactivating the protein .

• Metabolic Reprogramming:
  sdhC deficiency causes accumulation of succinate, which acts as an oncometabolite and can drive tumor progression through multiple mechanisms:

  • Activation of PI3K/AKT signaling pathways

  • Altered fatty acid metabolism, with increased lipid accumulation

  • Upregulation of enzymes like aldehyde dehydrogenase 3 family member A2 (ALDH3A2)

  • Suppression of fatty acid oxidation through decreased expression of acyl-coenzyme A oxidase 1 (ACOX1) and carnitine palmitoyltransferase 1A (CPT1A)

• SDH Complex Instability:
  Mutations in sdhC typically lead to destabilization of the entire SDH complex, resulting in negative SDHB immunohistochemical staining in tumor tissues. This phenomenon explains why mutations in any SDH subunit can produce similar clinical phenotypes .

What are the most informative biomarkers for assessing sdhC dysfunction in research samples?

For comprehensive assessment of sdhC dysfunction, researchers should consider multiple biomarkers:

• SDHB Immunohistochemistry (IHC):

  • Negative SDHB staining is a reliable indicator of SDH complex deficiency

  • Loss of any component of the SDH complex, including sdhC, results in negative SDHB staining

  • Serves as an excellent screening tool for identifying potential SDH-deficient tumors

• Metabolite Ratios:

  • Succinate:fumarate ratio is a direct metabolic indicator of SDH dysfunction

  • High ratios (>10-15) are strongly indicative of SDH deficiency

  • In confirmed cases, ratios can range dramatically, from ~10 to >80 depending on the severity of dysfunction and tissue type

• Gene Expression Profiling:

  • Assessment of downstream genes affected by sdhC deficiency

  • Key markers include enzymes involved in fatty acid metabolism (ALDH3A2, ACOX1, CPT1A)

  • PI3K/AKT pathway components can also serve as indicators of sdhC dysfunction

• Transcriptomic Analysis:

  • Detection of aberrant splicing events

  • Identification of retained intronic segments or exon skipping

  • Can reveal the molecular consequences of intronic or splice-site mutations

The following table summarizes typical biomarker findings in sdhC-deficient tumors based on research data:

How does sdhC deficiency contribute to tumorigenesis and cancer progression?

sdhC deficiency contributes to tumorigenesis and cancer progression through multiple interconnected mechanisms:

• Metabolic Reprogramming:
  sdhC deficiency leads to succinate accumulation, which acts as an oncometabolite that drives several pro-tumorigenic processes. Recent research has shown that SDHC knockdown promotes colorectal cancer metastasis by modulating the PI3K/AKT pathways and reprogramming lipid metabolism. This metabolic shift includes increased lipid accumulation through upregulation of ALDH3A2 and reduced fatty acid oxidation through suppression of ACOX1 and CPT1A expression .

• Genetic Second Hits:
  SDH-related tumor syndromes typically follow the two-hit hypothesis, requiring both a germline mutation and a somatic second hit. Studies have identified various mechanisms for this second hit:

  • Loss of heterozygosity (most common)

  • Somatic mutations

  • Rarely, epigenetic inactivation

  For example, in one family with a germline sdhC intronic variant, whole exome sequencing of tumors revealed chromosome 1 deletion with loss of wild-type sdhC in a paraganglioma, accompanied by a somatic gain-of-function KIT mutation in a gastrointestinal stromal tumor .

• Tissue-Specific Effects:
  sdhC deficiency affects different tissues in various ways:

  • In colorectal cancer, it enhances invasion and metastasis capacity

  • In liver cancer, it promotes multiplication and metastasis via ROS/NFκB signaling

  • In breast cancer, it promotes epithelial-mesenchymal transition and mitochondrial structural reconstruction

• Hereditary Cancer Syndromes:
  Germline sdhC mutations are associated with familial paraganglioma syndromes characterized by:

  • Autosomal dominant inheritance

  • Variable penetrance and expressivity

  • Development of multiple tumor types, including paragangliomas, gastrointestinal stromal tumors, and renal cell carcinomas

What experimental models best represent sdhC-associated cancer phenotypes for translational research?

Based on current research, several experimental models effectively represent sdhC-associated cancer phenotypes:

• Cell Line Models:

  • Targeted Knockdown/Knockout Systems:

    • siRNA-mediated knockdown in cancer cell lines (HCT116, SW480)

    • CRISPR-Cas9-mediated knockout systems

    • These approaches allow for investigation of direct effects of sdhC deficiency on cellular behavior

  • Overexpression Systems:

    • Models with enhanced SDHC expression provide valuable comparison points

    • Demonstrated to significantly decrease migratory and invasive capabilities in cancer cells

• In Vivo Metastasis Models:

  • Splenic Injection Model:

    • Injection of stable SDHC knockdown cells (e.g., HCT116-sh-SDHC) into mouse spleen

    • Enables assessment of liver metastasis formation

    • Has demonstrated significant increase in both number and size of metastatic nodules in SDHC-deficient conditions

  • Intravenous Injection Model:

    • Facilitates evaluation of lung metastasis

    • Complements the splenic model for comprehensive metastasis assessment

• Patient-Derived Models:

  • Tumor Organoids:

    • Three-dimensional cultures derived from patient tumor samples

    • Maintain tumor heterogeneity and microenvironment

    • Allow for personalized drug testing

  • Patient-Derived Xenografts (PDX):

    • Tumor fragments from patients implanted into immunodeficient mice

    • Preserve tumor architecture and heterogeneity

    • Particularly valuable for hereditary syndromes with sdhC mutations

• Familial Case Studies:

  • Analysis of families with hereditary sdhC mutations provides insights into:

    • Variable penetrance patterns

    • Diverse tumor manifestations

    • Long-term disease progression

    • For example, detailed analysis of Italian families with intronic sdhC variants revealed multiple tumor types with varying SDH deficiency markers

How can computational modeling enhance our understanding of sdhC mutations and their consequences?

Computational modeling offers powerful approaches for understanding sdhC mutations:

• Structural Modeling and Analysis:
  The human SDH complex can be modeled based on homologous structures (such as the pig counterpart) using sophisticated tools like UCSF Chimera software. This modeling approach allows researchers to:

  • Map specific mutations onto the three-dimensional structure

  • Calculate distances between mutated residues and functional sites (e.g., FAD binding site)

  • Compute solvent accessibility for each mutated residue in both the assembled SDH complex and individual subunits

  • These analyses can reveal whether mutations affect protein folding, stability, or interactions rather than directly impacting catalytic activity

• Protein Interaction Analysis:
  Tools like 'LIGPLOT' enable computation of schematic diagrams of interactions within proteins, allowing comparison of the local environment in wild-type versus mutated proteins. This helps elucidate how specific mutations disrupt key interactions that maintain the functional integrity of sdhC .

• Splicing Prediction Tools:
  Multiple splicing site predictors such as 'ASSP-Alternative Splicing Site Predictor' and NetGene2 'server' can predict the effect of noncoding mutations occurring near exon-intron boundaries. For instance, these tools successfully predicted that the SDHA deletion c.457-3_457-1 delCAG would create an alternative splicing site, leading to a frame shift and premature stop codon .

• Mutation Impact Prediction:
  Various computational tools can assess the potential impact of coding non-synonymous mutations on protein function. Research has shown high concordance between different prediction tools, despite their different algorithmic approaches, indicating robust prediction capabilities for sdhC mutations .

What are the emerging therapeutic approaches targeting sdhC-related metabolic pathways in cancer?

Several promising therapeutic approaches targeting sdhC-related metabolic alterations are emerging:

• Targeting Fatty Acid Metabolism:
  Recent research has demonstrated that SDHC knockdown promotes cancer metastasis by reprogramming fatty acid metabolism. Importantly, when fatty acid synthesis was experimentally blocked, the metastasis-promoting effects of SDHC silencing were reversed. This suggests that inhibitors of fatty acid synthesis could be effective therapeutic agents for SDHC-deficient tumors .

• PI3K/AKT Pathway Inhibition:
  SDHC deficiency activates the PI3K/AKT signaling axis, which leads to lipid accumulation and altered fatty acid metabolism. Various PI3K/AKT inhibitors are in clinical development and could potentially counteract the metabolic effects of SDHC deficiency .

• Targeting Specific Metabolic Enzymes:
  SDHC silencing upregulates expression of aldehyde dehydrogenase 3 family member A2 (ALDH3A2) while suppressing acyl-coenzyme A oxidase 1 (ACOX1) and carnitine palmitoyltransferase 1A (CPT1A). These enzymes represent potential therapeutic targets:

  • ALDH3A2 inhibitors could reduce lipid accumulation

  • ACOX1 or CPT1A activators might restore fatty acid oxidation rates

• Synthetic Lethality Approaches:
  Identifying genes that, when inhibited, cause selective death of SDHC-deficient cells but spare normal cells with intact SDHC function. This approach has been successful for other metabolic deficiencies and represents a promising direction for SDHC-deficient cancers.

• Biomarker-Guided Therapy:
  The use of SDHB immunohistochemistry and succinate:fumarate ratios can identify SDH-deficient tumors, including those with SDHC deficiency. These biomarkers could guide the application of targeted therapies in a precision medicine approach .