Recombinant Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD)

Shipped with Ice Packs
In Stock

Description

Molecular Composition and Organization

Succinate dehydrogenase comprises four distinct protein subunits encoded by a gene cluster typically denoted as sdhCDAB. This arrangement has been identified through sequencing studies of various organisms, including the rickettsial pathogen Coxiella burnetii . The sdhD gene specifically encodes the hydrophobic membrane anchor subunit, which works in concert with sdhC to anchor the catalytic components (sdhA and sdhB) to cellular membranes. This anchoring function is crucial for positioning the enzyme complex correctly within the mitochondrial inner membrane in eukaryotes or the cellular membrane in prokaryotes.

Evolutionary Conservation of sdhD

Studies have revealed significant evolutionary conservation of the sdhD subunit across diverse organisms. In Coxiella burnetii, the deduced amino acid sequence of sdhD demonstrates approximately 36.6% identity with its Escherichia coli homologue . While this level of conservation is lower than that observed for other SDH subunits such as sdhA and sdhB (which show 61.2% identity with their E. coli counterparts), it nevertheless highlights the fundamental importance of this subunit in maintaining proper enzyme function across different species .

Recombinant versions of sdhD have been produced from various organisms, including the archaeon Halobacterium salinarum , further demonstrating the ubiquitous nature of this protein across all domains of life. The availability of recombinant sdhD from diverse biological sources enables comparative studies that illuminate both conserved features and species-specific adaptations.

Expression Systems for Recombinant sdhD

The production of recombinant sdhD proteins utilizes various expression systems optimized for membrane proteins. Commercial availability of recombinant Halobacterium salinarum sdhD indicates successful implementation of such expression systems . The hydrophobic nature of sdhD presents particular challenges for recombinant expression, often requiring specialized host cells and solubilization techniques.

Research on the C. burnetii sdh gene cluster has demonstrated remarkable cross-species functionality. Plasmid constructs containing the complete C. burnetii sdhCDAB coding region and upstream regulatory elements successfully complemented an E. coli sdhA mutant (MOB252), resulting in a sixfold increase in SDH enzyme activity compared to the wild-type E. coli . This functional expression in a heterologous system underscores the conserved nature of SDH subunit interactions and suggests that recombinant expression can produce biologically active proteins.

Role in Succinate Dehydrogenase Complex Assembly

Recombinant sdhD has been instrumental in elucidating the assembly process of the complete SDH complex. The sdhD subunit, despite being the smallest component, plays a critical role in stabilizing the quaternary structure of the enzyme. Functional studies using recombinant proteins have shown that all four subunits are necessary for optimal enzyme activity, as demonstrated by the complementation experiments with C. burnetii sdhCDAB in E. coli sdhA mutants .

The successful expression of a functional SDH complex in heterologous systems indicates that the assembly process follows conserved mechanisms across different species. This conservation facilitates the use of recombinant proteins for studying complex formation and stability.

Membrane Anchoring Properties

The primary function of sdhD is to anchor the SDH complex to cellular membranes. Recombinant sdhD has been used to study the specific membrane-binding properties of this subunit, including its interactions with membrane lipids and its orientation within the lipid bilayer.

Studies with recombinant sdhD have revealed specific transmembrane domains that integrate into the lipid bilayer, providing stable anchoring for the entire enzyme complex. These structural features are essential for positioning the catalytic components correctly relative to other components of the respiratory chain.

Interactions with Other Subunits

Recombinant sdhD has facilitated detailed studies of protein-protein interactions within the SDH complex. The sdhD subunit interacts primarily with sdhC to form the membrane-anchoring domain of the complex, while also maintaining contacts with the catalytic subunits sdhA and sdhB.

These interactions are critical for both structural stability and functional activity of the enzyme. The complementation of E. coli sdhA mutants with the C. burnetii sdhCDAB genes demonstrates that these interactions are conserved enough across species to allow for functional assembly in heterologous systems .

SDHD Mutations in Head and Neck Paragangliomas

One of the most significant clinical associations of sdhD involves mutations linked to head and neck paragangliomas (HNPs). A comprehensive systematic review and meta-analysis of 42 studies encompassing 8,849 patients revealed that SDHD mutations represent the most common type of gene mutation in this context, identified in 747 patients across 39 studies .

Meta-regression analysis demonstrated a significant correlation between multifocality of HNPs and SDHD mutations, with a coefficient of 0.03 ± 0.006 (p < 0.0001) . This finding suggests that patients with SDHD mutations are more likely to develop multiple tumors compared to those with other genetic alterations. The pooled event ratio (PER) for SDHD mutations was calculated as 0.545 [95% CI, 0.462–0.626], indicating a substantial prevalence in this patient population .

Interestingly, while SDHD mutations were strongly associated with tumor multifocality, they did not show significant correlations with sex, age, tumor size, or familial occurrences . This specificity highlights the unique pathogenic mechanisms associated with SDHD dysfunction.

SDHD Promoter Mutations in Melanoma

The four most common hotspot promoter mutations (C523T, C524T, C541T, and C544T) were found to disrupt consensus binding sites for ETS transcription factors . Functional studies using luciferase reporter assays demonstrated that these mutations, particularly C523T and C524T, resulted in significant reductions in SDHD expression across multiple cell lines .

Table 1: Effect of Common SDHD Promoter Mutations on Transcription Factor Binding and Gene Expression

MutationPredicted Effect on Transcription Factor BindingEffect on Reporter ExpressionP-value Range
C523TDisrupts ETS binding sites, strongest effect on GABPASignificant reduction in all tested cell lines4.35×10⁻¹¹ to 9.37×10⁻⁷
C524TDisrupts ETS binding sites, similar to C523TSignificant reduction in all tested cell lines4.17×10⁻¹⁰ to 3.60×10⁻⁴
C541TCreates and alters consensus motifs, strongest effect on PRDM1Significant reduction in two of four cell lines0.0053 to 2.86×10⁻⁵
C544TCreates new motifs, strongest effect on IRF4Significant reduction in three of four cell lines0.043 to 6.30×10⁻⁶

Molecular Mechanisms of Pathogenicity

Detailed mechanistic studies have revealed how SDHD promoter mutations affect gene expression. Motif analyses predicted that mutations C523T and C524T would disrupt multiple transcription factor binding sites, with 13 out of 16 affected sites belonging to ETS transcription factors . These mutations had the strongest predicted effect on GABPA binding, with P-values increasing from 6.68×10⁻⁶ to 4.25×10⁻³ for both mutations .

Affinity purification coupled with mass spectrometry (AP-MS/MS) identified components of the GABP transcription factor complex, specifically GABPA and GABPB1, as proteins that preferentially bind to the wild-type SDHD promoter sequence . The mutations were shown to ablate this binding, providing a direct molecular mechanism for reduced SDHD expression.

Analysis of gene expression data from the TCGA SKCM dataset revealed significant positive correlations between SDHD mRNA levels and the expression of specific ETS transcription factors, particularly ELF1 and GABPA, in samples with wild-type SDHD promoters . The correlation coefficients were 0.46 (P = 4.40×10⁻⁸) for ELF1 and 0.42 (P = 8.57×10⁻⁷) for GABPA . These correlations were disrupted in samples harboring promoter mutations, further supporting the mechanism of reduced expression through impaired transcription factor binding.

Structure-Function Analysis

Recombinant sdhD proteins serve as invaluable tools for structure-function analysis. By producing pure preparations of the protein, researchers can conduct detailed studies of its structural characteristics, membrane interaction properties, and functional roles within the succinate dehydrogenase complex.

The commercial availability of recombinant Halobacterium salinarum sdhD facilitates such research . Additionally, the successful functional expression of C. burnetii sdhCDAB in E. coli demonstrates the feasibility of producing active enzymes for structure-function studies .

Table 2: Characteristics of Succinate Dehydrogenase Subunits Based on C. burnetii Studies

SubunitEncoded byAmino Acid Identity with E. coli HomologuePrimary Function
SdhAsdhA61.2%Catalytic activity (flavoprotein)
SdhBsdhB61.2%Iron-sulfur electron transfer
SdhCsdhCNot specified in search resultsMembrane anchoring
SdhDsdhD36.6%Hydrophobic membrane anchoring

Investigating Transcription Factor Interactions

Recombinant proteins have been instrumental in studying the molecular mechanisms by which SDHD promoter mutations affect gene expression. Band-shift experiments using recombinant human GABP (GABPA and GABPB) and ELF1 proteins have demonstrated specific binding to wild-type SDHD promoter sequences and reduced binding to mutant sequences .

These experiments involved mixing recombinant GABPA and GABPB at equimolar concentrations before adding the DNA oligonucleotides, followed by analysis using electrophoretic mobility shift assays . The resulting protein complexes were resolved on gels and transferred to nylon membranes for detection of the biotinylated oligonucleotides using streptavidin-HRP conjugate . This approach provided direct evidence of the transcription factor interactions affected by the promoter mutations.

Diagnostic and Therapeutic Applications

The association between SDHD mutations and specific disease phenotypes suggests potential diagnostic applications for recombinant sdhD proteins. These proteins could serve as standards or controls in assays designed to detect mutations or abnormal expression levels in patient samples.

Furthermore, the detailed understanding of how promoter mutations affect SDHD expression could inform therapeutic strategies aimed at restoring normal expression levels . Knowledge of HNP phenotypes associated with SDH-related mutations has the potential to influence the clinical management of affected patients . For instance, the correlation between SDHD mutations and tumor multifocality might warrant more comprehensive screening approaches for patients with these genetic alterations.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
sdhD; c0800; Succinate dehydrogenase hydrophobic membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
Target Protein Sequence
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
Uniprot No.

Target Background

Function

Membrane-anchoring subunit of succinate dehydrogenase (SDH).

Database Links

KEGG: ecc:c0800

STRING: 199310.c0800

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of sdhD in the succinate dehydrogenase complex?

Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) is one of the four essential subunits (SDHA-D) that compose the succinate dehydrogenase complex. The sdhD subunit, along with SDHC, forms the hydrophobic anchor embedded in the inner mitochondrial membrane in eukaryotes or the cytoplasmic membrane in prokaryotes. These two transmembrane subunits create the membrane domain that anchors the catalytic components to the membrane . The hydrophobic nature of sdhD is critical for maintaining the proper positioning of the enzyme complex within the membrane, facilitating electron transfer from the matrix to ubiquinone in the inner membrane .

How does sdhD interact with other subunits of the SDH complex?

The sdhD subunit has specific structural interactions with the other components of the SDH complex. It works in conjunction with SDHC to form the membrane domain, while SDHB is positioned between SDHA on the matrix side and the SDHC/SDHD membrane anchor. Together with SDHC, sdhD ligates a single heme between them. This arrangement creates a clear electron transfer pathway from FAD in SDHA, through the three Fe-S clusters in SDHB, to the quinone-binding site at the membrane interface where sdhD is positioned . This structural organization facilitates the functional role of SDH in both the tricarboxylic acid cycle and the electron transport chain.

What distinguishes sdhD across different species?

Recombinant sdhD proteins have been developed from various organisms, including Halobacterium salinarum and Rickettsia prowazekii . While the core function of anchoring the SDH complex to the membrane is preserved across species, there are notable structural variations that reflect evolutionary adaptations to different cellular environments. These variations may include differences in amino acid sequences, post-translational modifications, and interaction sites with other cellular components. Species-specific differences in sdhD can provide valuable insights into the evolutionary conservation of enzyme function and adaptation to diverse environmental conditions.

What are the optimal conditions for expressing recombinant sdhD in bacterial systems?

Expressing recombinant sdhD presents unique challenges due to its hydrophobic nature and membrane-associated characteristics. The most successful expression systems typically employ E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3). For optimal expression, researchers should:

  • Use low induction temperatures (16-20°C) to reduce inclusion body formation

  • Employ weaker promoters or lower inducer concentrations to slow protein expression

  • Supplement growth media with heme precursors since sdhD participates in heme binding

  • Consider co-expression with chaperones to improve proper folding

  • Include detergents suitable for membrane proteins in lysis and purification buffers

The yield of properly folded sdhD can be monitored through activity assays measuring electron transfer capability when reconstituted with other SDH subunits.

How can researchers effectively solubilize and purify recombinant sdhD while maintaining its native structure?

Purification of recombinant sdhD requires careful attention to its membrane protein nature. Based on established protocols for SDH components, the following methodology is recommended:

  • Initial solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin that preserve protein-protein interactions

  • Affinity chromatography utilizing poly-histidine tags commonly engineered at the N- or C-terminus of recombinant sdhD

  • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Validation of structural integrity through circular dichroism to confirm alpha-helical content characteristic of transmembrane domains

What controls should be included in experiments studying recombinant sdhD function?

Robust experimental design for recombinant sdhD research requires appropriate controls to validate findings and address the specific challenges of working with membrane proteins. Recommended controls include:

Control TypePurposeImplementation
Negative controlEstablish baselineEmpty vector expression in same system
Positive controlValidate system functionalityWell-characterized membrane protein in same expression system
Structural mutantsVerify key functional domainsSite-directed mutagenesis of conserved residues
Cross-species comparisonAssess evolutionary conservationParallel expression of sdhD from multiple organisms
Reconstitution controlVerify complex assemblyAssembly with other purified SDH subunits

These controls help distinguish genuine experimental results from artifacts that might arise due to the challenging nature of membrane protein research. The experimental design should also incorporate replicate measurements to account for variability inherent in membrane protein studies.

How can researchers effectively study sdhD interactions with other SDH subunits?

Studying the interactions between sdhD and other SDH subunits requires specialized techniques that account for the membrane-associated nature of the complex. Effective methodologies include:

  • Co-immunoprecipitation assays using tagged versions of sdhD and potential interacting partners

  • Proximity labeling approaches such as BioID or APEX2 to identify proteins in close proximity to sdhD in native environments

  • Reconstitution experiments in liposomes or nanodiscs to study assembly in membrane-like environments

  • Crosslinking mass spectrometry to map specific interaction interfaces

  • Blue native PAGE to analyze intact complexes and subcomplexes containing sdhD

When designing these experiments, it's important to consider that SDHB forms a sandwich between SDHA and the membrane subunits (SDHC and SDHD), creating a structural bridge that facilitates electron transfer . This arrangement suggests that direct interactions between SDHA and sdhD may be limited, while SDHB-sdhD interactions are likely more extensive.

What are the most effective methods for analyzing the structural integrity of recombinant sdhD?

Analyzing the structural integrity of recombinant sdhD requires specialized techniques suitable for membrane proteins. The most effective analytical methods include:

  • Circular dichroism (CD) spectroscopy to assess secondary structure composition, particularly alpha-helical content characteristic of transmembrane domains

  • Limited proteolysis coupled with mass spectrometry to identify exposed regions versus protected transmembrane regions

  • Thermal shift assays adapted for membrane proteins to evaluate stability in different detergent environments

  • Cysteine accessibility studies to probe topology when inserted in membranes

  • Cryo-electron microscopy for high-resolution structural analysis when assembled with other SDH subunits

Data interpretation should focus on comparing results with the known alpha-helical transmembrane structure of sdhD and its expected topology in the membrane with specific attention to regions involved in heme binding with SDHC .

How can researchers distinguish between proper and improper folding of recombinant sdhD?

Distinguishing properly folded recombinant sdhD from misfolded variants is critical for ensuring reliable experimental results. Effective analytical approaches include:

Analytical MethodIndicators of Proper FoldingIndicators of Misfolding
Gel filtration chromatographyDefined elution peak consistent with monomer or physiological oligomerAggregation or multiple aberrant peaks
SDS-PAGE solubilityRemains soluble in mild detergentsForms insoluble aggregates
Functional reconstitutionAssembles with other SDH subunitsFails to form complete complex
Heme binding capacitySuccessfully coordinates heme with SDHCInability to coordinate heme
Membrane insertion assayProperly inserts into liposomesRemains in aqueous phase or forms aggregates

The capacity to participate in heme ligation with SDHC is a particularly important indicator of proper folding, as this is a defining functional characteristic of properly folded sdhD in its native environment .

How can site-directed mutagenesis of sdhD inform understanding of SDH complex assembly?

Site-directed mutagenesis of sdhD provides valuable insights into the structural determinants of SDH complex assembly and function. A systematic approach should:

  • Target conserved residues identified through multiple sequence alignment of sdhD across species

  • Focus on amino acids at the interface with other subunits, particularly those interfacing with SDHB and SDHC

  • Investigate residues involved in heme coordination, as sdhD and SDHC together ligate a single heme

  • Examine the role of specific transmembrane domains in membrane anchoring and complex stability

Results from such studies can reveal the hierarchical assembly process of the SDH complex and identify critical residues that, when mutated, prevent proper complex formation. Given that SDHB is sandwiched between SDHA on the matrix side and SDHC/SDHD in the membrane , mutations affecting this interface can provide insights into the stepwise assembly process of the complex.

What approaches can be used to study the role of sdhD in electron transfer within the SDH complex?

Investigating the role of sdhD in electron transfer requires specialized techniques that can track electron movement through the protein complex. Recommended approaches include:

  • EPR (Electron Paramagnetic Resonance) spectroscopy to monitor redox states of Fe-S clusters and heme

  • FRET (Förster Resonance Energy Transfer) assays with fluorescently labeled subunits to track conformational changes during electron transfer

  • Stop-flow kinetics to measure electron transfer rates when reconstituted with other subunits

  • Electrochemical methods such as protein film voltammetry to directly measure electron transfer capabilities

  • Computational modeling of electron tunneling pathways through the assembled complex

These methods should focus on the structural features that facilitate electron transfer from the Fe-S clusters in SDHB through the sdhD/SDHC membrane domain to ubiquinone at the binding site. The transmembrane orientation of sdhD is critical for maintaining the proper geometry for efficient electron transfer along this pathway .

What are common challenges in recombinant sdhD expression and how can they be addressed?

Recombinant sdhD expression faces several challenges typical of membrane proteins. Common issues and solutions include:

ChallengeManifestationSolution Strategy
Toxicity to host cellsPoor growth after inductionUse tightly regulated expression systems; lower expression temperature
Inclusion body formationInsoluble protein aggregatesCo-express with chaperones; use fusion tags that enhance solubility
Low expression yieldMinimal detectable proteinOptimize codon usage; test different E. coli strains
Improper membrane insertionLack of function despite expressionInclude proper signal sequences; optimize membrane mimetics
Instability during purificationProtein degradationAdd protease inhibitors; minimize purification steps

For particularly challenging expressions, considering alternative expression systems such as yeast (Pichia pastoris) or insect cells may provide better results, especially when expressing eukaryotic sdhD variants that may require specific post-translational modifications.

How can researchers optimize reconstitution of sdhD with other SDH subunits?

Reconstituting sdhD with other SDH subunits requires careful optimization to achieve functional enzyme complexes. Based on the structural understanding that SDHB is sandwiched between SDHA and the membrane subunits (SDHC and sdhD) , researchers should:

  • Consider the assembly order: Start with membrane components (SDHC and sdhD) in appropriate detergent or lipid environments before adding the catalytic components

  • Optimize detergent-to-protein and lipid-to-protein ratios to provide suitable hydrophobic environments

  • Include appropriate cofactors, particularly heme, which is coordinated between SDHC and sdhD

  • Control redox conditions to protect sensitive Fe-S clusters in SDHB

  • Use gentle mixing methods that minimize protein denaturation while allowing sufficient interaction time

Successful reconstitution can be verified by measuring succinate dehydrogenase activity, monitoring electron transfer to artificial electron acceptors, or through structural techniques such as blue native PAGE to confirm the presence of the fully assembled complex.

How might structural studies of sdhD contribute to understanding mitochondrial disease mechanisms?

Structural studies of sdhD have significant potential to illuminate mechanisms underlying mitochondrial diseases, particularly those associated with SDH dysfunction. Future research directions should focus on:

  • High-resolution structural analysis of disease-associated sdhD mutations to understand their impact on protein folding, stability, and interactions

  • Investigation of how structural alterations in sdhD affect assembly of the entire SDH complex

  • Examination of how sdhD structural elements contribute to the formation of the ubiquinone binding site, a critical junction for electron transfer

  • Exploration of potential interactions between sdhD and other mitochondrial membrane proteins beyond the SDH complex

  • Development of structural models that predict the impact of novel mutations for clinical interpretation

These approaches could provide mechanistic insights into conditions associated with SDH deficiency and potentially identify structural targets for therapeutic intervention in mitochondrial disorders.

What novel experimental approaches might advance our understanding of sdhD function in different cellular contexts?

Emerging technologies offer exciting opportunities to expand our understanding of sdhD function beyond its established role in the SDH complex. Promising approaches include:

  • CRISPR-Cas9 genome editing to create cellular models with specific sdhD modifications or fluorescent tags at the endogenous locus

  • Single-molecule tracking of tagged sdhD to monitor dynamics within the mitochondrial membrane

  • Cryogenic electron microscopy (cryo-EM) to visualize the SDH complex at near-atomic resolution in different functional states

  • Proteomics approaches to identify novel interaction partners of sdhD beyond the established SDH complex

  • Systems biology approaches integrating transcriptomics, proteomics, and metabolomics to understand the broader consequences of sdhD dysfunction

These cutting-edge techniques could reveal unexpected functions of sdhD in cellular homeostasis, mitochondrial dynamics, or signaling pathways beyond its established role in electron transport and the tricarboxylic acid cycle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.