Recombinant Sugarcane streak virus Movement protein (V2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant V2 protein is expressed in E. coli and purified via affinity chromatography. Key steps include:

  1. Cloning: The V2 gene is inserted into a prokaryotic expression vector with a His-tag.

  2. Induction: Protein expression is triggered under optimized conditions (e.g., IPTG induction).

  3. Purification:

    • Affinity Chromatography: Utilizes nickel columns to bind His-tagged proteins.

    • Reconstitution: Lyophilized protein is dissolved in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

Challenges:

  • Protein Solubility: The protein may form inclusion bodies in E. coli, requiring denaturing agents for solubilization.

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquoting is recommended .

Diagnostic Tools

  • Antibody Production: The recombinant V2 protein can serve as an antigen for generating polyclonal antibodies to detect SSV in sugarcane samples .

  • Western Blotting: Confirmed via SDS-PAGE and Western blotting using anti-His antibodies .

Viral Pathogenicity Studies

  • Movement Mechanism: V2 likely facilitates viral cell-to-cell movement by interacting with plasmodesmata, though specific functional studies are lacking.

  • Comparative Genomics: Sequence alignment with related viruses (e.g., SCSMV) may reveal conserved motifs critical for movement .

Comparative Analysis with Related Viruses

SSV and Sugarcane Streak Mosaic Virus (SCSMV) are distinct potyviruses, but their movement proteins share functional parallels.

FeatureSSV V2SCSMV P3-PIPO
Expression MechanismDirect translationPolymerase slippage
Length109 aa139–141 aa
FunctionMovement proteinMovement protein
Genomic PositionEncoded as a separate ORFExpressed via frameshift

Unresolved Questions and Future Directions

  1. Functional Characterization:

    • Mechanism of Action: How V2 interacts with host proteins to facilitate viral spread.

    • Host Range: Whether V2 influences specificity toward sugarcane or other grasses.

  2. Diagnostic Utility:

    • Cross-Reactivity: Testing V2 antibodies against SCSMV or other streak viruses.

  3. Therapeutic Potential:

    • RNA Silencing Suppression: Assessing whether V2 inhibits host RNA interference, as seen in SCSMV’s P1 protein .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on your location and the purchase method. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag during production.
Synonyms
V2; Movement protein; MP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Sugarcane streak virus (isolate South Africa) (SSV) (Sugarcane streak virus (isolate Natal))
Target Names
V2
Target Protein Sequence
MDSFGRAPPLWPQSALPRVPGAAPSSSGLPWSRVGEIAIFTFVAVLALYLLWSWVGRDLL LVLKARRGGTTEELTFGPRERHSLPAVAVARVENPPCPSGSVEARPFTG
Uniprot No.

Target Background

Function
This protein is involved in the transport of viruses within and between cells.
Database Links

KEGG: vg:940474

Protein Families
Mastrevirus movement protein family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is Sugarcane streak virus Movement protein (V2) and what is its role in viral infection?

The Sugarcane streak virus (SSV) Movement protein (V2) is a 109-amino acid protein that plays a critical role in facilitating cell-to-cell movement of the viral genetic material during infection. As a movement protein, V2 likely modifies plasmodesmata to increase their size exclusion limit, allowing the virus to spread from initially infected cells to neighboring cells. The protein is encoded by the V2 gene in the SSV genome and has been identified in isolates from South Africa and Natal regions . Unlike the related sugarcane streak mosaic virus (SCSMV), which belongs to the Potyviridae family and has a different genomic organization, SSV is a geminivirus with a distinct movement protein structure and function .

How does SSV V2 protein differ from movement proteins in other plant viruses?

SSV V2 protein differs from movement proteins in other plant viral families in several significant ways:

  • Size: At 109 amino acids, the SSV V2 protein is relatively small compared to movement proteins from other plant virus groups, which can range from 30-50 kDa .

  • Functional mechanism: Unlike the triple gene block movement proteins found in some plant viruses that work in conjunction with other viral proteins, the SSV V2 appears to function more independently, though it likely interacts with host factors.

  • Host range: The SSV V2 protein is specialized for movement in sugarcane and potentially other grass species, whereas movement proteins from viruses with broader host ranges may have different structural features to accommodate diverse plant cell types.

  • Sequence homology: SSV V2 shares limited sequence homology with movement proteins from unrelated plant viruses, reflecting its specialized evolutionary adaptation to its host range .

What expression systems are most effective for producing recombinant V2 protein?

The most effective expression system for recombinant SSV V2 protein production is bacterial expression using E. coli, as demonstrated in commercial preparations . The protein can be successfully expressed with an N-terminal His-tag to facilitate purification without apparent loss of structural integrity. For optimal expression:

  • Codon optimization: Adapting the V2 coding sequence to E. coli codon usage preferences can significantly improve expression yields.

  • Expression conditions: Induction at lower temperatures (16-20°C) often reduces inclusion body formation and improves the proportion of soluble protein.

  • Fusion partners: Beyond the His-tag commonly used, fusion with solubility-enhancing partners like MBP (maltose-binding protein) or GST (glutathione S-transferase) can improve both expression and solubility.

  • Alternative systems: For functional studies requiring post-translational modifications, plant-based expression systems like Nicotiana benthamiana transient expression may be more appropriate, especially given the successful development of viral vectors based on related viruses like SCSMV .

What are the optimal purification strategies for recombinant V2 protein?

Based on the properties of the His-tagged recombinant V2 protein, the following purification strategy is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective for capturing the His-tagged V2 protein from clarified cell lysates.

  • Buffer conditions: Using Tris/PBS-based buffers at pH 8.0 with the addition of 6% trehalose helps maintain protein stability during purification and storage .

  • Intermediate purification: Size exclusion chromatography can remove aggregates and provide a more homogeneous protein preparation.

  • Storage: After purification, the protein should be stored in aliquots at -20°C or -80°C, with 5-50% glycerol added as a cryoprotectant to prevent freeze-thaw damage .

  • Quality control: SDS-PAGE analysis should confirm purity greater than 90% for most research applications .

What analytical methods are most informative for characterizing V2 protein structure and function?

To thoroughly characterize the recombinant V2 protein, researchers should employ a combination of complementary analytical approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

    • Dynamic light scattering (DLS) to evaluate protein homogeneity and detect aggregation

    • Limited proteolysis to identify structured domains and flexible regions

  • Functional assays:

    • RNA binding assays (electrophoretic mobility shift assays, filter binding assays)

    • Plasmodesmata permeability assays in plant protoplasts or tissue

    • Cell-to-cell movement complementation assays in model plants

  • Interaction studies:

    • Pull-down assays with plant cell extracts to identify host protein partners

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to quantify binding affinities

    • Yeast two-hybrid screening to discover novel protein interactions

How can recombinant V2 protein be used to study virus-host interactions?

Recombinant V2 protein serves as a valuable tool for investigating virus-host interactions through several experimental approaches:

  • Proteomics-based interactome mapping:

    • Affinity purification coupled with mass spectrometry (AP-MS) using His-tagged V2 protein as bait

    • Proximity-dependent biotin identification (BioID) with V2 protein fusions to identify proximal interacting partners in planta

    • Comparative interactomics between susceptible and resistant sugarcane varieties to identify resistance-associated factors

  • Subcellular localization studies:

    • Immunolocalization of V2 protein in infected plant tissues using antibodies against the recombinant protein

    • Live-cell imaging with fluorescently tagged V2 protein to track movement dynamics

  • Host defense response analysis:

    • Assessment of V2 protein effects on host RNA silencing pathways

    • Evaluation of plant innate immunity activation through defense gene expression profiling

    • Investigation of V2 protein ability to suppress or activate specific plant defense responses

What transgenic approaches can be used to study V2 protein function in planta?

Several transgenic strategies can elucidate V2 protein function in planta:

  • Overexpression systems:

    • Constitutive expression of V2 protein to examine effects on plant development and defense responses

    • Inducible expression systems to control timing of V2 protein production

    • Tissue-specific promoters to target V2 expression to specific plant tissues

  • Mutational analysis:

    • Expression of V2 protein variants with targeted mutations to identify functional domains

    • Alanine-scanning mutagenesis to systematically evaluate the contribution of specific amino acid residues

    • Chimeric proteins combining domains from V2 proteins of different viral isolates to identify host-specificity determinants

  • CRISPR-Cas9 approaches:

    • Editing of host factors predicted to interact with V2 protein

    • Creation of knockout lines for potential V2-interacting proteins

    • Generation of sugarcane varieties with modified plasmodesmata components that might restrict V2-mediated viral movement

How can infectious clone technology be applied to study V2 protein in the context of viral infection?

Infectious clone technology offers powerful approaches to study V2 protein function within the viral infection cycle:

  • Reverse genetics approaches:

    • Introduction of specific mutations in the V2 gene to assess their impact on viral movement and pathogenicity

    • Replacement of V2 with variants from other viral isolates to investigate host specificity determinants

    • Creation of V2 deletion mutants complemented in trans with recombinant V2 protein

  • Reporter virus systems:

    • Development of SSV infectious clones expressing fluorescent proteins to visualize infection dynamics

    • Creation of V2-reporter protein fusions to track localization during authentic infection

    • Bimolecular fluorescence complementation (BiFC) systems to visualize V2 protein interactions in vivo

  • Vector development:

    • Adaptation of related viral vector systems like those developed for SCSMV could provide templates for SSV-based vectors

    • Creation of expression vectors based on SSV for protein production in plants

    • Development of virus-induced gene silencing (VIGS) vectors to study host factor requirements for V2 function

What are the current challenges in understanding V2 protein structure-function relationships?

Several significant challenges currently limit our comprehensive understanding of V2 protein structure-function relationships:

  • Structural determination challenges:

    • Difficulty in obtaining high-resolution crystal structures due to potential membrane association

    • Limited NMR structural data for plant viral movement proteins generally

    • Challenges in producing sufficient quantities of properly folded protein for structural studies

  • Functional ambiguities:

    • Incomplete understanding of the precise mechanism by which V2 modifies plasmodesmata

    • Limited knowledge of host factor interactions in sugarcane compared to model plants

    • Uncertainty about potential multifunctionality beyond cell-to-cell movement

  • Technical limitations:

    • Difficulty in establishing efficient transformation systems for sugarcane

    • Challenges in applying high-throughput screening approaches in non-model crop systems

    • Limited availability of genetic resources for sugarcane compared to model plant species

What evolutionary insights can be gained from comparative analysis of V2 proteins across viral isolates?

Comparative analysis of V2 proteins from different viral isolates can provide valuable evolutionary insights:

  • Selective pressure analysis:

    • Calculation of dN/dS ratios to identify regions under positive or negative selection

    • Comparison with selection patterns observed in related viruses like SCSMV, which shows evidence of negative selection pressure on its proteins

    • Identification of amino acid positions that may be involved in host adaptation

  • Phylogenetic relationships:

    • Construction of phylogenetic trees based on V2 sequences to understand viral evolution

    • Correlation of genetic clustering with geographical distribution, similar to approaches used for SCSMV isolates

    • Investigation of potential recombination events that may have shaped V2 evolution

  • Structure-function conservation:

    • Identification of conserved motifs across viral movement proteins that may indicate functional importance

    • Analysis of variability in specific domains to understand host adaptation mechanisms

    • Correlation of sequence conservation patterns with known functional domains in related viral proteins

What emerging technologies hold promise for advancing V2 protein research?

Several cutting-edge technologies show particular promise for advancing V2 protein research:

  • Structural biology innovations:

    • Cryo-electron microscopy for membrane-associated protein complexes

    • Integrative structural biology approaches combining multiple data types

    • AlphaFold2 and other AI-based structure prediction tools to model V2 protein structure

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize V2 protein localization at plasmodesmata with nanometer precision

    • Light sheet microscopy for whole-plant imaging of viral movement dynamics

    • Correlative light and electron microscopy (CLEM) to connect V2 localization with ultrastructural features

  • High-throughput functional genomics:

    • CRISPR screens to identify host factors required for V2 function

    • Synthetic biology approaches to create minimal functional variants of V2 protein

    • Multi-omics integration to connect V2 function with global changes in host gene expression, protein abundance, and metabolite profiles

Table: Comparison of Known Properties of Sugarcane Streak Virus V2 Protein and Related Viral Movement Proteins

PropertySSV V2 ProteinSCSMV Movement-Related ProteinsOther Geminivirus MPs
Protein Length109 amino acids Part of polyprotein (3,130 aa) Typically 100-150 aa
Molecular Weight~12-13 kDa (estimated)Varies by specific protein10-15 kDa range
Expression SystemE. coli with His-tag Agrobacterium-based vectors Various systems
Storage StabilityStable with 6% trehalose, pH 8.0; 50% glycerol recommended for long-term storage Not specifically reportedVaries by protein
Functional DomainsContains membrane-association domains (predicted)Movement function in polyprotein contextDNA binding, oligomerization domains
Host RangeSugarcane, primarily in South Africa Sugarcane in Asia, Africa, Iran Host-specific adaptations
Cellular LocalizationLikely plasmodesmata-associated (based on function)Not specifically reportedPlasmodesmata, nucleus (some)
Recombination EvidenceLimited data availableDetected in several isolates Common in many geminiviruses
Selection PressureNot specifically reportedNegative selection (dN/dS < 1) Varies by virus and host

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.