Recombinant Suid herpesvirus 1 Envelope glycoprotein D

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Envelope glycoprotein D; gD; Protein gp50
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-402
Protein Length
Full Length of Mature Protein
Species
Suid herpesvirus 1 (strain Rice) (SuHV-1) (Pseudorabies virus (strain Rice))
Target Protein Sequence
ADVDAVPAPTFPPPAYPYTESWQLTLTTVPSPFVGPADVYHTRPLEDPCGVVALISDPQV DRLLNEAVAHRRPTYRAHVAWYRIADGCAHLLYFIEYADCDPRQVFGRCRRRTTPMWWTP SADYMFPTEDELGLLMVAPGRFNEGQYRRLVSVDGVNILTDFMVALPEGQECPFARVDQH RTYKFGACWSDDSFKRGVDVMRFLTPFYQQPPHREVVNYWYRKNGRTLPRAHAAATPYAI DPARPSAGSPRPRPRPRPRPRPKPEPAPATPAPPDRLPEPATRDHAAGGRPTPRPPRPET PHRPFAPPAVVPSGWPQPAEPFQPRTPAAPGVSRHRSVIVGTGTAMGALLVGVCVYIFFR LRGAKGYRLLGGPADADELKAQPGP
Uniprot No.

Target Background

Function

Envelope glycoprotein that binds to host cell entry receptors. It may trigger membrane fusion with the host cell by recruiting the fusion machinery comprising gB and gH/gL.

Protein Families
Herpesviridae glycoprotein D family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is the genomic structure of SHV-1 gD and how does it impact recombinant expression?

The challenge of amplifying this GC-rich sequence can be overcome by using specialized PCR methods. Research has demonstrated that adding 1M betaine as a PCR enhancer significantly facilitates amplification of the entire gD gene. Betaine reduces the melting temperature of GC-rich regions, allowing for more efficient primer annealing and polymerase extension .

A typical methodology for successfully amplifying SHV-1 gD includes:

  • Design of primers with appropriate modifications for subsequent cloning

  • Preparation of PCR reaction mixture containing 1M betaine

  • Implementation of thermal cycling conditions optimized for GC-rich templates

  • Gel purification of the specific amplicon (~1700 bp)

  • Cloning into appropriate vectors (e.g., Gateway entry vectors)

What expression systems are most effective for producing functional recombinant SHV-1 gD?

The baculovirus-insect cell system (BICS) has proven particularly effective for producing immunologically authentic full-length recombinant SHV-1 gD . This expression system supports proper folding and post-translational modifications, especially glycosylation, which is critical for maintaining the native antigenic properties of gD.

Research has shown that recombinant SHV-1 gD produced in the BICS reacts strongly with sera from SHV-1 infected pigs, confirming its antigenic authenticity . This makes the recombinant protein suitable for both diagnostic applications and potential vaccine development.

The methodological workflow typically involves:

  • Construction of a recombinant baculovirus encoding the SHV-1 gD gene

  • Infection of insect cells (typically Sf9 or High Five™ cells)

  • Optimization of expression conditions (MOI, time of harvest)

  • Purification of secreted or cell-associated gD protein

  • Validation of glycosylation and antigenic properties

How do glycosylation patterns affect SHV-1 gD functionality?

SHV-1 gD contains four potential N-linked glycosylation sites . Glycosylation plays a crucial role in protein folding, transport, and function. Studies with HSV gD have demonstrated that a triple mutant lacking N-glycosylation sites (gD-QAA) failed to block apoptosis induced by gD-deficient viruses, while still maintaining competence for cell fusion and nectin-1 binding .

This finding suggests that glycosylation is particularly important for certain functions of gD, such as interaction with the mannose-6-phosphate receptor to block apoptosis, but may be less critical for receptor binding and fusion functions .

To experimentally investigate the role of glycosylation in SHV-1 gD:

  • Generate site-directed mutants at N-glycosylation sites (changing Asn to Gln)

  • Express wild-type and mutant proteins in appropriate systems

  • Compare functional properties using receptor binding and fusion assays

  • Analyze glycan structures using mass spectrometry and lectin binding

What cellular receptors does SHV-1 gD interact with and how does this compare to other alphaherpesviruses?

SHV-1 gD, like other alphaherpesvirus gD proteins, interacts with specific cellular receptors to mediate viral entry. Studies have shown that SHV-1 gD binds directly to nectin-1, a cell adhesion molecule of the immunoglobulin superfamily .

The affinities of different alphaherpesvirus gD proteins for human nectin-1 vary significantly:

VirusRelative Affinity for Human Nectin-1Notes
PrV gD10× higher than HSV-1 gDSuggests nectin-1 may be important for natural host infection
HSV-1 gDModerate affinityAlso binds HVEM and modified heparan sulfate
BHV-1 gDWeak affinityMay use other receptors in natural host

The higher affinity of PrV gD for human nectin-1 suggests that a porcine nectin-1 homolog may serve as an important entry receptor during natural infection in pigs .

Unlike HSV gD, which can utilize multiple receptors including HVEM (HveA), nectin-1 (HveC), nectin-2 (HveB), and 3-O-sulfated heparan sulfate, SHV-1 gD appears to have a more restricted receptor usage, primarily interacting with nectin-1 .

What methodological approaches can map the receptor-binding domains of SHV-1 gD?

Several complementary techniques can be employed to map receptor-binding domains:

  • Competition binding assays: Research has shown that PrV gD and HSV-1 gD compete for binding to the V domain of nectin-1, suggesting they bind to a common region despite their low amino acid similarity (22-33% identity) .

  • Mutagenesis studies: Systematic mutation of specific residues or domains followed by binding assays can identify critical regions. For HSV gD, mutations in residues 222, 223, and 215 severely impair nectin-1 binding .

  • Domain swapping: Creating chimeric proteins with domains from different herpesvirus gD proteins can identify functional domains. Studies have shown that a chimeric fusion protein containing the receptor binding domain of HSV-1 gD fused to a truncated version of gH can substitute for gH/gL in pseudorabies virus .

  • Structural approaches: X-ray crystallography of gD in complex with soluble receptor fragments can provide atomic-level details of the interaction interface.

A typical experimental workflow might include:

  • Generation of gD variants through site-directed mutagenesis

  • Expression and purification of soluble forms of gD and receptors

  • Binding assays using techniques such as ELISA, surface plasmon resonance, or co-immunoprecipitation

  • Functional validation using cell-based entry or fusion assays

How can recombinant SHV-1 gD be used to study viral entry mechanisms?

Several experimental approaches utilize recombinant SHV-1 gD to investigate entry mechanisms:

  • Soluble receptor competition assays: Recombinant soluble gD can block viral entry by competing with virion gD for receptor binding. Research with HSV has shown that viruses lacking glycoprotein C (gC) are more sensitive to inhibition by soluble nectin-1, with entry reduced to 21% versus 48% for gC-expressing virus following pretreatment with 1 μM soluble nectin-1 .

  • Virus-receptor co-sedimentation assays: This technique measures the ability of virions to interact with soluble receptors. Studies with HSV show that neutralizing anti-gD antibodies can inhibit co-sedimentation of virions with soluble nectin-1 .

  • Reporter virus entry assays: Viruses carrying reporter genes (e.g., β-galactosidase) under the control of immediate-early promoters allow quantification of successful entry events .

  • Complementation of gD-null viruses: Transfection of cells with plasmids expressing wild-type or mutant gD can complement the infectivity defect of gD-null viruses, allowing assessment of gD functionality.

What cell-cell fusion assays can be implemented to study SHV-1 gD function?

Cell-cell fusion assays provide a quantifiable system to study the fusion function of viral glycoproteins. For alphaherpesviruses, these typically involve co-expression of four essential glycoproteins: gD, gB, gH, and gL. Several established methodologies include:

  • Luciferase reporter-based fusion assay: This highly quantitative approach involves:

    • Transfection of "effector cells" with plasmids expressing gB, gD, gH, gL, and T7 RNA polymerase

    • Transfection of "target cells" expressing gD receptors with a plasmid containing the luciferase gene under control of the T7 promoter

    • Co-culture of the two cell populations

    • Measurement of luciferase activity as an indicator of cell fusion

  • Syncytia formation assay: A more traditional approach involving:

    • Co-expression of viral glycoproteins in receptor-bearing cells

    • Visualization and quantification of multinucleated cells (syncytia)

    • Immunoperoxidase staining to enhance detection

  • Split reporter complementation: This involves:

    • Expression of one fragment of a reporter protein in effector cells

    • Expression of the complementary fragment in target cells

    • Reconstitution of reporter activity upon cell fusion

These assays can be used to compare wild-type and mutant forms of gD and to test potential fusion inhibitors.

How can recombinant SHV-1 gD be optimized for diagnostic ELISA development?

Recombinant SHV-1 gD produced in the baculovirus-insect cell system has been successfully used to develop indirect ELISA tests with sensitivity and specificity comparable to commercial tests . This approach is particularly valuable for developing Differentiation of Infected from Vaccinated Animals (DIVA) strategies in regions using gE-deleted marker vaccines.

Key considerations for optimization include:

  • Antigen quality parameters:

    • Expression system selection (baculovirus-insect cell system recommended)

    • Purification to >95% homogeneity

    • Verification of glycosylation and proper folding

    • Optimal coating concentration determination (typically 1-5 μg/ml)

  • Assay condition optimization:

    • Buffer composition and pH

    • Blocking agent selection (BSA, casein, etc.)

    • Sample dilution factors

    • Incubation times and temperatures

  • Detection system selection:

    • Secondary antibody options

    • Enzyme conjugate (HRP, AP)

    • Substrate selection for desired sensitivity/detection range

  • Validation protocol development:

    • Reference panel testing (known positive and negative samples)

    • Cut-off determination using ROC curve analysis

    • Inter- and intra-assay variability assessment

    • Cross-reactivity evaluation with related pathogens

What are the advantages of recombinant gD-based assays over whole-virus antigen tests?

Recombinant gD-based assays offer several significant advantages:

  • Enhanced safety: Elimination of the need to work with infectious virus during test production.

  • DIVA capability: Tests based on recombinant gD can be used in conjunction with tests detecting anti-gE antibodies to differentiate infected from vaccinated animals in areas where gE-deleted marker vaccines are used .

  • Improved standardization: Batch-to-batch consistency is easier to maintain with recombinant proteins compared to whole-virus preparations.

  • Increased specificity: Using a single defined viral protein can reduce cross-reactivity with antibodies against other viral components or related viruses.

  • Scalability: Recombinant protein production can be more easily scaled up to meet demand compared to virion growth and purification.

  • Cost-effectiveness: For large-scale screening programs, recombinant antigen production may be more economical than viral cultivation.

How can structural biology approaches enhance our understanding of SHV-1 gD function?

Although no crystal structure of SHV-1 gD has been reported in the literature, several structural biology approaches could significantly advance our understanding:

  • X-ray crystallography: Determining the structure of SHV-1 gD alone and in complex with receptors would provide atomic-level details of binding interfaces and conformational states. Studies with HSV gD have shown that the protein undergoes significant conformational changes upon receptor binding, with the N-terminus forming a hairpin turn that affects the accessibility of key residues like F223 .

  • Cryo-electron microscopy (cryo-EM): This technique could visualize gD in the context of intact virions or in complexes with receptors and other viral glycoproteins, providing insights into the spatial organization of the entry machinery.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach could identify regions of SHV-1 gD that undergo conformational changes upon receptor binding or interaction with other viral glycoproteins.

  • Molecular dynamics simulations: Computational approaches based on homology models could predict conformational dynamics and identify potential druggable sites.

  • Small-angle X-ray scattering (SAXS): This technique could provide low-resolution structural information about flexible regions and conformational ensembles of SHV-1 gD in solution.

What emerging technologies might advance SHV-1 gD research?

Several cutting-edge technologies hold promise for advancing SHV-1 gD research:

  • CRISPR/Cas9 genome editing: This technology enables precise modification of the viral genome to introduce specific mutations in gD or to create reporter viruses for mechanistic studies.

  • Single-molecule techniques: Methods such as single-molecule FRET could directly visualize conformational changes in gD during receptor binding and fusion activation.

  • Nanobody development: The generation of camelid single-domain antibodies (nanobodies) against specific conformational states of gD could provide tools to trap and study intermediate states in the fusion process.

  • Artificial intelligence for structure prediction: Tools like AlphaFold could generate increasingly accurate structural models of SHV-1 gD and its complexes, even in the absence of experimental structures.

  • High-throughput mutagenesis approaches: Deep mutational scanning combined with functional assays could comprehensively map the functional landscape of SHV-1 gD.

  • Organoid and tissue culture systems: Advanced 3D culture systems that better recapitulate the natural host environment could provide more physiologically relevant models for studying viral entry.

How conserved is gD across alphaherpesviruses, and what does this tell us about function?

Despite performing similar functions, glycoprotein D shows only moderate sequence conservation across alphaherpesviruses. The gD homologs of HSV-1, PrV (SHV-1), and BHV-1 share only 22-33% amino acid identity . This limited sequence identity contrasts with their shared ability to mediate viral entry, suggesting that structural conservation may be more important than sequence conservation.

Interestingly, phylogenetic analysis of SHV-1 gD sequences from different geographical locations reveals clustering according to the region of isolation. Studies have shown that SHV-1 isolates from Asia form a distinct cluster from those isolated in the Western hemisphere, with few exceptions . This geographical clustering may reflect adaptation to regional host genetic variations.

VirusReceptor UsageBinding Affinity for Nectin-1Other Functions
HSV-1 gDHVEM, nectin-1, nectin-2, 3-O-sulfated heparan sulfateModerateBlocks apoptosis, blocks superinfection
SHV-1 gDPrimarily nectin-1High (10× higher than HSV-1)Not required for cell-to-cell spread
BHV-1 gDNectin-1WeakSimilar to HSV-1

This divergence in receptor affinity and preference may reflect adaptation to different host species and tissues.

How can research findings from HSV gD be applied to SHV-1 gD studies?

Despite sequence differences, many functional studies on HSV gD can inform research on SHV-1 gD:

  • Domain mapping: Studies in HSV-1 have identified specific domains involved in receptor binding, fusion triggering, and apoptosis inhibition. For instance, mutations at residues 222, 223, and 215 in HSV gD impair nectin-1 binding . Similar regions in SHV-1 gD may have comparable functions.

  • Receptor interactions: Research showing that PrV gD and HSV-1 gD compete for binding to the V domain of nectin-1 suggests they bind to a common region despite sequence divergence . This allows researchers to use knowledge about HSV gD-receptor interfaces to guide SHV-1 studies.

  • Fusion mechanisms: The understanding that HSV gD undergoes conformational changes upon receptor binding that then trigger activity in gB and gH/gL provides a framework for investigating SHV-1 fusion mechanisms.

  • Neutralizing antibody epitopes: Knowledge about neutralizing epitopes in HSV gD can guide epitope mapping in SHV-1 gD and the development of targeted vaccines or diagnostics.

  • Therapeutic strategies: Approaches that target HSV gD function, such as soluble receptor fragments or inhibitory peptides, may be adaptable to SHV-1 based on functional conservation.

What strategies can overcome the challenges of working with the high-GC content SHV-1 gD gene?

The extremely high GC content of the SHV-1 gD gene (average 74.8%, with regions reaching 94%) presents significant technical challenges. Researchers have developed several effective strategies:

  • PCR amplification enhancement:

    • Addition of 1M betaine as a PCR enhancer

    • Use of specialized GC-enhancer buffer systems

    • Selection of polymerases optimized for GC-rich templates

    • Modified thermal cycling conditions with longer denaturation steps

  • Cloning approaches:

    • Direct cloning of PCR products into TA vectors

    • Use of Gateway cloning systems for efficient transfer between vectors

    • Consideration of synthetic gene synthesis for particularly difficult regions

  • Codon optimization:

    • Redesign of the coding sequence to reduce GC content while maintaining amino acid sequence

    • Elimination of potential secondary structures that impede amplification

    • Removal of cryptic splice sites that might affect expression in eukaryotic systems

  • Expression optimization:

    • Selection of appropriate promoters for the expression system

    • Inclusion of enhancer elements to improve transcription of GC-rich sequences

    • Addition of introns to improve mRNA processing and export

These methodological adaptations have enabled successful amplification, cloning, and expression of the full-length SHV-1 gD gene, facilitating further functional and structural studies.

What experimental designs can effectively compare wild-type and mutant SHV-1 gD functions?

Systematic comparison of wild-type and mutant SHV-1 gD functions requires carefully designed experimental approaches:

  • Receptor binding assays:

    • ELISA-based binding assays using purified gD variants and soluble receptors

    • Surface plasmon resonance for quantitative binding kinetics

    • Cell-based flow cytometry assays using fluorescently labeled gD

  • Fusion assays:

    • Quantitative luciferase-based cell-cell fusion assays

    • Split reporter complementation assays

    • Microscopic quantification of syncytia formation

  • Viral complementation studies:

    • Trans-complementation of gD-null viruses with wild-type or mutant gD

    • Analysis of entry efficiency using reporter gene expression

    • Assessment of cell-to-cell spread through plaque size measurement

  • Structural analysis:

    • Limited proteolysis to assess conformational differences

    • Antibody binding profiles to detect structural alterations

    • Thermal stability assays to measure folding integrity

  • Comparative immunogenicity:

    • Analysis of antibody responses to wild-type versus mutant gD

    • Epitope mapping using peptide arrays

    • Neutralization assays with sera raised against different gD variants

These complementary approaches provide a comprehensive assessment of how specific mutations affect the multiple functions of SHV-1 gD.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.