Recombinant Suid herpesvirus 1 Envelope protein US9 homolog

Shipped with Ice Packs
In Stock

Description

Comparative Analysis of US9 Homologs

US9 proteins are conserved across alphaherpesviruses, but functional divergence exists. A key study compared homologs from SuHV-1 (PRV), VZV, HSV-1, EHV-1, and BHV-1 :

VirusLocalizationTopologyFunctional Compensation for PRV US9
PRV (SuHV-1)TGN, lipid raftsType II membraneNative function
VZVTGNType II membraneNo compensation
HSV-1TGN, ERType II membraneNo compensation
EHV-1TGNType II membraneFull compensation
BHV-1TGNType II membraneFull compensation

Key Findings:

  • EHV-1 and BHV-1 homologs fully restore axonal sorting in PRV US9-null mutants, while VZV and HSV-1 homologs fail .

  • Functional divergence correlates with sequence differences in sorting domains and lipid raft interactions .

Production and Applications

The recombinant US9 homolog is synthesized via codon-optimized cDNA in E. coli or mammalian systems :

ParameterDetails
Expression SystemE. coli (codon-optimized cDNA cloned in expression vectors)
Purity>90% (via affinity chromatography)
Storage BufferTris-based buffer with 50% glycerol (store at -20°C or -80°C)
Amino Acid SequenceResidues 1–106 (full-length); includes hydrophobic C-terminal anchor

Applications:

  • Vaccine Development: Targets immune responses against envelope glycoproteins .

  • Diagnostic Tools: Used in ELISA or Western blot assays to detect SuHV-1 antibodies .

  • Structural Studies: EGFP fusions enable live-cell imaging of viral trafficking pathways .

Research Challenges and Future Directions

  • Functional Specificity: Why EHV-1/BHV-1 homologs compensate for PRV US9, but others do not, remains unclear .

  • Therapeutic Targets: Inhibiting US9-lipid raft interactions could disrupt viral assembly .

  • Cross-Species Transmission: Homologs in zoonotic alphaherpesviruses (e.g., EHV-1) warrant further study .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please specify your needs when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Envelope protein US9 homolog; 11 kDa protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Suid herpesvirus 1 (strain Rice) (SuHV-1) (Pseudorabies virus (strain Rice))
Target Protein Sequence
MPTAAPADMDTFDPSAPVPTSVSNPAADVLLAPKGPRSPLRPQDDSDCYYSESDNETPSE FLRRVGRRQAARRRRRRCLMGVAISAAALVICSLSALIGGIIARHV
Uniprot No.

Target Background

Function
US9 is essential for the anterograde spread of the infection throughout the host nervous system. Along with the gE/gI heterodimer, US9 plays a role in the sorting and transport of viral structural components towards axon tips.
Protein Families
Alphaherpesvirinae envelope protein US9 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host Golgi apparatus membrane; Single-pass type II membrane protein. Host smooth endoplasmic reticulum membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein. Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN), maybe through an interaction with PACS-1 sorting protein.

Q&A

What is the membrane topology of PRV Us9 protein?

PRV Us9 is a type II tail-anchored (TA) membrane protein with a distinctive topology where the C-terminal domain forms a transmembrane anchor, while the N-terminal domain extends into the cytoplasm. This topology is consistent across Us9 homologs from other alphaherpesviruses including VZV, HSV-1, EHV-1, and BHV-1 . This membrane orientation is critical for its function in sorting viral components into axons. The type II topology is established by a conserved basic region preceding the transmembrane domain, which was initially misinterpreted as a nuclear localization signal in some homologs such as HSV-1 Us9 . This region follows the "positive-inside rule" that helps establish protein orientation in the lipid bilayer .

Where does PRV Us9 protein primarily localize within infected cells?

The PRV Us9 protein predominantly localizes to the trans-Golgi network (TGN) within infected cells . This subcellular localization pattern is consistent across Us9 homologs from various alphaherpesviruses. Experimental visualization using enhanced green fluorescent protein (EGFP) fusion constructs has confirmed this localization pattern . The enrichment of Us9 in this compartment is functionally significant as it positions the protein at a critical sorting station for membranes destined for axonal transport. Additionally, Us9 is highly enriched in lipid raft microdomains, specialized membrane regions that may serve as platforms for viral assembly and transport .

What is the relationship between Us9 phosphorylation and its function?

Us9 exists in phosphorylated forms that appear to have specific functional implications. Approximately 75% of Us9-positive vesicles in axons contain detectable levels of phospho-Us9, suggesting that phosphorylation may regulate its activity in viral transport . Phosphorylation occurs on conserved serine residues, which are present not only in PRV Us9 but also in homologs from other alphaherpesviruses including HSV-1 and HSV-2 . This post-translational modification likely influences Us9's interactions with cellular transport machinery and may be critical for efficient sorting of viral components into axons. The phosphorylation status of Us9 appears to be spatially regulated, with different distributions in lipid raft versus non-raft membrane domains .

Can Us9 homologs from different alphaherpesviruses functionally substitute for PRV Us9?

Functional substitution experiments have revealed that only some Us9 homologs can compensate for the loss of PRV Us9 in axonal sorting and anterograde spread of infection. Specifically:

VirusUs9 HomologCan Substitute for PRV Us9Anterograde Spread Efficiency
PRVPRV Us9Yes (control)3.7 × 10^6 PFU (median)
EHV-1EHV-1 Us9YesFull compensation
BHV-1BHV-1 Us9YesFull compensation
VZVVZV Us9NoNo effective compensation
HSV-1HSV-1 Us9NoNo effective compensation

This functional divergence occurs despite all homologs sharing type II membrane topology and trans-Golgi network localization . The inability of human alphaherpesvirus Us9 proteins (from VZV and HSV-1) to substitute for PRV Us9 suggests host-specific adaptations in axonal transport mechanisms that may reflect differences in neurotropism and pathogenesis between human and veterinary alphaherpesviruses.

How can recombinant Us9 proteins be generated for experimental studies?

Generation of recombinant Us9 proteins typically involves PCR amplification of the Us9 open reading frame (ORF) using virus-specific templates and primers with appropriate restriction enzyme linkers . A standardized approach includes:

  • PCR amplification with high-fidelity polymerase (e.g., Pfu DNA polymerase) using primers containing restriction enzyme linkers (e.g., EcoRI and BamHI)

  • PCR conditions: initial denaturation at 96°C for 5 min; followed by 2 cycles of 96°C for 1 min, 55°C for 30 s, and 72°C for 45 s; then 25 cycles of 96°C for 1 min, 62°C for 45 s, and 72°C for 45 s; with a final extension at 72°C for 4 min

  • Digestion of PCR products with appropriate restriction enzymes

  • Ligation into expression vectors (e.g., pEGFP-N1 for C-terminal EGFP fusion)

  • Transformation into E. coli and confirmation by restriction digest and sequencing

For functional studies, recombinant viruses expressing various Us9 homologs can be constructed using homologous recombination techniques, placing the Us9 gene under control of promoters such as the CMV immediate-early promoter in the gG locus .

What methods are effective for studying Us9 membrane topology?

Membrane topology of Us9 can be effectively studied using selective permeabilization immunofluorescence assays . This approach involves:

  • Transfection of cells with Us9-EGFP fusion constructs

  • Fixation with paraformaldehyde (4% in PBS for 10 min)

  • Immunolabeling under non-permeabilizing conditions (antibodies against GFP in 3% BSA-PBS)

  • Parallel immunolabeling under permeabilizing conditions (addition of 0.5% saponin to the antibody solution)

  • Detection with fluorophore-conjugated secondary antibodies (e.g., Alexa Fluor 546)

  • Confocal microscopy analysis to determine which protein domains are accessible to antibodies

This methodology allows researchers to distinguish between cytoplasmic and lumenal/extracellular domains, confirming the type II topology of Us9 proteins where the N-terminus faces the cytoplasm and the C-terminus extends into the lumen or extracellular space.

How can researchers assess the role of Us9 in neuronal transport?

The compartmentalized neuronal culture system provides a robust method for studying Us9-dependent anterograde transport . This approach involves:

  • Isolation and culture of superior cervical ganglia (SCG) neurons in compartmentalized chambers

  • Plating neuronal cell bodies in one compartment (S) while allowing axons to extend through a methocellulose barrier into a separate neurite compartment (N)

  • After axon outgrowth (approximately 2 weeks), plating indicator cells (e.g., PK15 cells) in the neurite compartment

  • Infection of neuronal cell bodies with various Us9 mutant or chimeric viruses

  • Collection and titration of virus from both compartments at defined time points post-infection

  • Quantification of viral spread by plaque assay to determine anterograde transport efficiency

This system allows for quantitative assessment of Us9 function by measuring the ability of virus to spread from neuronal cell bodies to indicator cells exclusively via axonal transport mechanisms, providing a functional readout for Us9 activity.

How does phosphorylation regulate Us9 function in axonal transport?

Phosphorylation appears to be a critical regulatory mechanism for Us9 function, with phosphorylated Us9 detected in approximately 75% of Us9-positive axonal vesicles . Research indicates that phosphorylation occurs on conserved serine residues present across different alphaherpesvirus Us9 homologs . The functional significance of this modification likely relates to:

  • Modulation of Us9 interactions with cellular transport machinery

  • Regulation of Us9 incorporation into transport vesicles

  • Potential roles in sorting viral components at the trans-Golgi network

The distribution of phosphorylated Us9 appears to differ between lipid raft and non-raft membrane domains, suggesting compartmentalized regulation of its phosphorylation state . Advanced studies using phosphomimetic and phosphodeficient mutations can help elucidate the precise role of specific phosphorylation events in Us9 function.

What is the relationship between Us9's association with lipid rafts and its function?

Us9 is highly enriched in lipid raft microdomains, specialized membrane platforms that may facilitate viral assembly and transport . The functional significance of this association appears to involve:

  • Concentration of Us9 with other viral and cellular components required for transport

  • Facilitation of interactions with molecular motors and adaptor proteins

  • Potential roles in membrane curvature and vesicle formation

Experimental approaches to study this relationship include lipid raft flotation assays, where cellular membranes are fractionated following detergent extraction and ultracentrifugation on density gradients . These assays reveal that Us9 phosphorylation patterns differ between raft and non-raft domains, suggesting that lipid raft association may influence Us9 modification and function . Understanding this relationship is critical for developing a comprehensive model of how Us9 orchestrates directional transport of viral components.

How do Us9 homologs interact differently with host cell machinery?

The inability of human alphaherpesvirus Us9 homologs (from VZV and HSV-1) to functionally substitute for PRV Us9, despite structural similarities, suggests differential interactions with host cell machinery . These differences may involve:

  • Species-specific adaptor protein recognition

  • Varying affinities for components of the kinesin-based transport machinery

  • Differential recognition by cellular kinases resulting in altered phosphorylation patterns

  • Virus-specific interactions with other viral proteins that mediate transport

Co-immunoprecipitation studies using GFP-tagged Us9 variants can identify specific binding partners . The species-specificity of functional substitution (with veterinary but not human alphaherpesvirus Us9 homologs able to replace PRV Us9) suggests co-evolution of viral transport proteins with host-specific cellular machinery, potentially reflecting adaptations to different neural circuits across host species.

What are common challenges in expressing and detecting Us9 proteins?

Researchers frequently encounter several challenges when working with Us9 proteins:

  • Low abundance of Us9 in infected cells, making detection challenging

  • Potentially weak reactivity of antibodies against Us9 peptides, as noted in HSV-1 Us9 studies

  • Variable detectability of phosphorylated versus non-phosphorylated forms

  • Distinguishing membrane-associated versus potentially soluble forms

Solutions include the use of epitope-tagged Us9 constructs (particularly GFP fusions) for enhanced detection, development of phospho-specific antibodies like 2D5E6 for PRV Us9 , and careful optimization of fixation and permeabilization conditions for immunofluorescence studies. When performing biochemical analyses, considerations for membrane protein extraction and handling are essential to preserve the native properties of these tail-anchored membrane proteins.

How can researchers differentiate between Us9-dependent and independent transport mechanisms?

Distinguishing Us9-dependent from Us9-independent transport can be challenging but is critical for understanding the precise role of Us9 in viral dissemination. Effective approaches include:

  • Parallel analysis of wild-type, Us9-null, and complemented viruses in compartmentalized neuronal cultures

  • Quantitative assessment of anterograde spread using titering of virus from neurite compartments

  • Live-cell imaging of fluorescently labeled viral particles to track individual transport events

  • Analysis of co-localization between Us9 and other viral structural proteins during axonal transport

  • Electron microscopy immunohistochemistry to precisely localize Us9 relative to viral structures

The combination of these approaches allows researchers to definitively attribute specific transport events to Us9 function versus other viral or cellular mechanisms that may contribute to anterograde spread.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.