Recombinant Suid herpesvirus 1 Glycoprotein K (gK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please include them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
gK; UL53; Envelope glycoprotein K; Syncytial protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-312
Protein Length
full length protein
Species
Suid herpesvirus 1 (strain Kaplan) (SuHV-1) (Pseudorabies virus (strain Kaplan))
Target Names
gK
Target Protein Sequence
GLGAYYATVARLPHPVVYAALPLGEDAAGGAPDWEAFNATAIYVAPNETDALSPALRDRA RVVYARRDCRAYLWDVHFRLAAVAWLLYAAFVYARQERRMFGPFRDPAEFLTPEKYTLNY AASVLAATVIGCSYTKFAWYMAELATRRAALSRDLREDPITLAHRHPTLIALILLELGLR LGARMALFTTLGVTRAPCALVFPLYARALVWIFVLAVGALELLAATLPHIARVSGATATP ARSDGGRAALGVCGACCSTVLAGIFAKALYLCLLVGGVLLFLHYERHITIFG
Uniprot No.

Target Background

Function
This glycoprotein likely regulates membrane fusion events during the secondary envelopment of cytoplasmic capsids. This process involves budding into specific trans-Golgi network (TGN)-derived membranes.
Protein Families
Alphaherpesvirinae glycoprotein K family
Subcellular Location
Host cell membrane; Multi-pass membrane protein. Host endosome membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of SHV-1 glycoprotein K?

SHV-1 glycoprotein K (gK) is a structural component of the virion envelope, appearing as a 32-kDa polypeptide in infected cell lysates and as a 36-kDa protein in purified virion preparations. The molecular weight difference reflects post-translational modifications. When treated with endoglycosidase H, gK is reduced to a 34-kDa protein, while N-glycosidase F treatment results in a 32-kDa protein. This indicates that virion gK is modified by N-linked glycans of both complex and high-mannose type . The protein is encoded by a gene homologous to herpes simplex virus type 1 (HSV-1) UL53, establishing its evolutionary relationship within the broader herpesvirus family.

How is SHV-1 gK typically detected in research settings?

SHV-1 gK can be detected using immunological methods with specific antibodies. In published research, a rabbit antiserum raised against a 40-kDa glutathione S-transferase-gK fusion protein expressed in Escherichia coli has been used for Western blot analysis to successfully detect the protein in both infected cell lysates and purified virion preparations . While there are no specific details about commercially available antibodies in the search results, researchers typically develop these tools by expressing recombinant forms of the protein as immunogens, similar to approaches documented for other SHV-1 glycoproteins like glycoprotein E (gE).

What are the key functional roles of gK in the SHV-1 replication cycle?

Glycoprotein K plays several critical roles in the SHV-1 replication cycle:

  • Virus egress: Functional analysis indicates gK has an essential role in virus egress from infected cells. Mutant viruses with interrupted gK expression show markedly reduced ability to spread from cell to cell, forming only single infected cells or small foci of infected cells when propagated in non-complementing cell lines .

  • Reinfection inhibition: The presence of gK appears important for inhibiting immediate reinfection of cells. Ultrastructural studies of gK mutants revealed numerous nucleocapsids directly beneath the plasma membrane in stages typical of the entry process, a phenomenon not observed in wild-type virus infections .

  • Viral yield: gK mutations result in approximately 30-fold reduction in virus yield, demonstrating its importance in productive infection .

  • Penetration kinetics: gK mutants show delayed entry into cells, although this function appears less critical than its role in egress, as the plating efficiency of gK-mutant viruses was similar to wild-type virus .

Like other herpesvirus glycoproteins, gK is likely involved in crucial infection steps including attachment to and penetration into target cells and direct cell-to-cell spread .

What expression systems are most effective for producing recombinant SHV-1 gK, and how do they compare?

While the search results don't provide specific information about gK expression systems, insights can be drawn from successful approaches with other SHV-1 glycoproteins:

For recombinant glycoprotein production, the baculovirus-insect cell system (BICS) has proven effective for expressing SHV-1 glycoproteins like gE. This system allows for production of fully processed, antigenically active foreign glycoproteins with proper post-translational modifications . The insect cell system is particularly valuable for viral glycoproteins as it facilitates:

  • High-level expression of complex proteins

  • Proper protein folding and processing

  • Post-translational modifications including glycosylation

  • Production of immunologically authentic proteins

For researchers pursuing gK expression, the choice of system should be guided by the intended application. BICS would be recommended for producing glycosylated, conformationally correct gK for structural studies, vaccine development, or diagnostic applications, while bacterial systems might be sufficient for generating antigens for antibody production.

What PCR challenges might researchers encounter when amplifying the SHV-1 gK gene, and how can these be overcome?

Although the search results don't specifically address PCR challenges for the gK gene, they highlight significant issues with amplifying GC-rich sequences in other SHV-1 glycoproteins. The gE gene, for instance, has an extremely high GC content (75% average), making PCR amplification difficult .

For researchers attempting to amplify the gK gene, similar challenges may arise if the sequence has comparable GC content. Effective strategies include:

  • Use of PCR enhancers: Betaine (1M concentration) has proven effective as a PCR enhancer for amplifying GC-rich sequences in SHV-1 . Betaine reduces the melting temperature of GC-rich sequences, facilitating amplification.

  • Modified PCR protocols: Methods specifically designed for high-GC content sequences may be necessary. These might include longer denaturation times, higher denaturation temperatures, or specialized polymerases.

  • Sequence analysis: Analyzing the target sequence using a sliding window approach (e.g., 50 base pair window) to identify regions of extremely high GC content can help in designing primers that avoid the most challenging sections .

These approaches should be considered by researchers encountering difficulties in amplifying SHV-1 gK or other GC-rich viral genes.

How can researchers effectively design functional studies to evaluate the role of gK in SHV-1 pathogenesis?

Based on published methodologies, researchers can design functional studies for SHV-1 gK using these approaches:

  • Gene interruption/deletion strategies: The UL53 open reading frame (encoding gK) can be interrupted, for example after codon 164, by insertion of expression cassettes like gG-lacZ or by insertion of heterologous genes as demonstrated with the bovine herpesvirus 1 gB gene . This creates mutant viruses for functional studies.

  • Complementation assays: Developing complementing cell lines that express gK is crucial for propagating gK-deficient viruses. Comparing virus behavior in complementing versus non-complementing cells provides insights into gK functions .

  • Phenotypic analysis parameters:

    • Plaque size and morphology analysis

    • Virus yield quantification using plaque assays

    • Penetration kinetics studies measuring viral entry rates

    • Ultrastructural examination using electron microscopy to visualize virion assembly, morphogenesis, and membrane interactions

  • In vivo pathogenesis studies: While not detailed in the search results for gK specifically, animal models could be used to assess neuroinvasion, spread, and virulence of gK mutants compared to wild-type virus, similar to approaches used for other glycoproteins.

These methodological approaches would allow researchers to systematically characterize the specific contributions of gK to viral replication, cell-to-cell spread, and pathogenesis.

What are the considerations for developing a recombinant gK-based subunit vaccine against SHV-1?

Developing a recombinant gK-based subunit vaccine would require addressing several key considerations:

  • Expression system selection: The baculovirus-insect cell system has demonstrated success for producing immunologically authentic viral glycoproteins for vaccine development, as shown with gE . This system preserves important post-translational modifications that may be critical for proper immune recognition.

  • Immunogenicity assessment: Before full vaccine development, preliminary immunization trials in appropriate animal models (e.g., mice) would be needed to confirm that recombinant gK elicits robust immune responses against SHV-1. Similar approaches with recombinant gE showed promising results when mice immunized with baculovirus-expressed gE mounted strong antibody responses detectable by immunoblotting against semi-purified SHV-1 virus extracts .

  • Protein purification strategy: For subunit vaccines, developing efficient purification protocols that maintain protein conformation is essential. Affinity chromatography approaches (such as immobilized metal affinity chromatography for His-tagged proteins) have proven effective for other SHV-1 glycoproteins .

  • Adjuvant selection: Appropriate adjuvants would need testing to enhance immune responses to the recombinant protein while minimizing adverse effects.

  • DIVA capability assessment: Like gE-deleted vaccines, gK-based approaches would need evaluation for their ability to allow differentiation of infected from vaccinated animals (DIVA), which is crucial for eradication campaigns .

  • Comparative protection studies: Ultimately, comparison of protection efficacy between gK-based subunit vaccines and current gE-deleted live attenuated or inactivated vaccines would be required to demonstrate value.

How can recombinant SHV-1 gK be utilized in developing diagnostic assays for distinguishing infected from vaccinated animals?

While the search results don't specifically address gK-based diagnostics, the development of ELISA tests based on recombinant glycoproteins for DIVA (differentiating infected from vaccinated animals) purposes is well-documented for gE . Similar principles could apply to gK-based diagnostics:

  • Assessment of gK expression in vaccine strains: Researchers would first need to determine if current vaccine strains lack or have modified gK expression. The DIVA strategy depends on using a viral protein that is present in wild-type infections but absent or modified in vaccinated animals.

  • Recombinant gK production: Expressing full-length recombinant gK using the baculovirus-insect cell system could provide antigen for ELISA development, following approaches successful with gE . The protein would need purification via methods like immobilized metal affinity chromatography.

  • Optimization of ELISA protocols:

    • Determining optimal antigen coating concentrations

    • Establishing appropriate serum dilutions

    • Selecting secondary antibodies with optimal specificity and sensitivity

    • Developing appropriate positive and negative controls

  • Test validation: Extensive testing with serum panels from:

    • Confirmed infected animals

    • Vaccinated, uninfected animals

    • Naïve animals

  • Performance assessment: Statistical analysis of sensitivity, specificity, and ROC (Receiver Operating Characteristic) curves would be needed to establish appropriate cutoff values and determine test reliability .

  • Comparative analysis: Comparing the performance of gK-based assays with established gE-based tests and other diagnostic methods like virus neutralization assays would be necessary to demonstrate value and complementarity.

What is the recommended protocol for expressing and purifying recombinant SHV-1 gK?

Based on successful approaches with other SHV-1 glycoproteins, a recommended protocol for expressing and purifying recombinant gK would include:

  • Gene amplification and cloning:

    • Design primers flanking the complete gK open reading frame

    • Include 1M betaine in PCR reactions if the sequence is GC-rich

    • Clone the amplified gene into an appropriate Gateway entry vector (e.g., pENTR/D-TOPO)

    • Verify sequence integrity by sequencing multiple independent clones

  • Baculovirus vector construction:

    • Transfer the gK sequence to a baculovirus destination vector using recombination-based cloning

    • Include a C-terminal 6X His-tag for purification

    • Place the gene under control of the polyhedrin promoter for high-level expression

    • Generate recombinant baculovirus stocks according to established protocols

  • Protein expression in insect cells:

    • Infect High Five insect cells with the recombinant baculovirus at optimal MOI

    • Harvest cells 48-72 hours post-infection when protein expression reaches maximum levels

    • Prepare cell extracts using appropriate lysis buffers containing protease inhibitors

  • Protein purification:

    • Purify His-tagged gK using Ni-NTA affinity chromatography

    • Elute with imidazole-containing buffers in a step or gradient fashion

    • Analyze purified fractions by SDS-PAGE and Western blotting with anti-His antibodies or specific anti-gK antibodies if available

    • Pool pure fractions and dialyze against appropriate storage buffer

  • Quality control:

    • Verify protein identity by mass spectrometry

    • Assess glycosylation status using glycosidase treatments

    • Confirm immunological activity using sera from infected animals

This approach should yield properly folded and post-translationally modified recombinant gK suitable for various research applications.

How does one design and conduct functional complementation assays for SHV-1 gK?

Functional complementation assays are crucial for studying essential viral proteins like gK. Based on published methodologies, the following protocol is recommended:

  • Generation of gK-deficient virus:

    • Create a gK-null mutant by inserting a marker gene (e.g., lacZ) into the gK open reading frame

    • The insertion should disrupt gK expression but maintain surrounding gene function

    • For example, interruption after codon 164 has been successfully used for SHV-1 gK

  • Development of complementing cell lines:

    • Clone the wild-type gK gene into a mammalian expression vector

    • Transfect the construct into appropriate cells (e.g., Vero cells)

    • Select stable transfectants using appropriate selection markers

    • Verify gK expression by immunoblotting

    • Clone cells to establish lines with consistent expression levels

  • Virus propagation:

    • Propagate the gK-deficient virus on complementing cells

    • Purify and titrate virus stocks on both complementing and non-complementing cells

    • Calculate complementation efficiency by comparing titers

  • Functional assays:

    • Compare plaque morphology on complementing vs. non-complementing cells

    • Measure virus penetration kinetics in both cell types

    • Quantify virus yields from single-step growth curves

    • Examine virus ultrastructure by electron microscopy to detect assembly defects

  • Data analysis and interpretation:

    • Functions dependent on gK will show rescue in complementing cells

    • Functions independent of gK will be similar in both cell types

    • Partial complementation may indicate complex functions requiring precise expression levels or timing

This systematic approach enables detailed characterization of gK functions in the viral life cycle.

What techniques are most effective for analyzing the glycosylation patterns of recombinant SHV-1 gK?

Glycosylation analysis is crucial for characterizing viral glycoproteins. For SHV-1 gK, the following approaches are recommended based on successful techniques used with similar viral glycoproteins:

  • Enzymatic deglycosylation assays:

    • Endoglycosidase H (Endo H) treatment to remove high-mannose and some hybrid oligosaccharides

    • N-glycosidase F (PNGase F) treatment to remove all N-linked glycans

    • Comparison of mobility shifts by SDS-PAGE and Western blotting reveals the presence and types of N-linked glycans

  • Glycan-specific lectin binding:

    • Use lectins with different glycan specificities (e.g., ConA for mannose, WGA for N-acetylglucosamine)

    • Perform lectin blotting or lectin affinity chromatography

    • Detection of binding patterns indicates specific glycan structures

  • Mass spectrometry analysis:

    • Tryptic digestion of purified protein

    • Analysis of glycopeptides by LC-MS/MS

    • Identification of specific glycan structures and attachment sites

  • Site-directed mutagenesis:

    • Identify potential N-glycosylation sites (N-X-S/T) in the gK sequence

    • Mutate these sites individually or in combination

    • Analyze effects on protein size, antigenicity, and function

For SHV-1 gK specifically, enzymatic deglycosylation has previously revealed that virion gK is modified by N-linked glycans of both complex and high-mannose type, as evidenced by differential mobility shifts after Endo H versus PNGase F treatment . This approach provides a foundation for more detailed glycan characterization.

What are common challenges in the expression of recombinant SHV-1 gK and how can they be addressed?

Based on experiences with similar viral glycoproteins, researchers might encounter these common challenges when expressing recombinant SHV-1 gK:

  • PCR amplification difficulties:

    • Challenge: High GC content making gene amplification difficult

    • Solution: Use PCR enhancers like 1M betaine; design primers avoiding extremely GC-rich regions; employ specialized polymerases for GC-rich templates

  • Low expression levels:

    • Challenge: Poor expression of transmembrane glycoproteins

    • Solution: Optimize codon usage for expression system; try different promoters; express truncated versions (ectodomain only); test multiple cell lines; optimize infection parameters (MOI, time of harvest)

  • Protein misfolding and aggregation:

    • Challenge: Improper folding leading to inclusion bodies or aggregates

    • Solution: Reduce expression temperature; co-express chaperones; optimize lysis and purification buffers; include appropriate detergents for membrane proteins

  • Poor solubility:

    • Challenge: Membrane proteins often have low solubility

    • Solution: Use appropriate detergents (e.g., NP-40, Triton X-100); test different solubilization buffers; consider using fusion tags that enhance solubility

  • Purification difficulties:

    • Challenge: Multiple conformations or degradation products

    • Solution: Optimize purification protocols; use size exclusion chromatography as a final purification step; include protease inhibitors throughout purification; perform limited proteolysis analysis

  • Loss of antigenicity:

    • Challenge: Recombinant protein not recognized by antibodies against native protein

    • Solution: Verify glycosylation status; test native vs. denaturing conditions for antibody recognition; use multiple antibodies recognizing different epitopes

Systematic optimization of these parameters should help overcome most challenges in recombinant gK expression.

How can researchers validate the structural and functional authenticity of recombinant SHV-1 gK?

Validating that recombinant gK accurately represents the native viral protein requires multiple complementary approaches:

  • Biochemical characterization:

    • Compare molecular weight with native gK from purified virions

    • Analyze glycosylation patterns using enzymatic deglycosylation (Endo H and PNGase F)

    • Compare peptide maps after protease digestion

  • Immunological validation:

    • Reactivity with monoclonal and polyclonal antibodies against native gK

    • Ability to induce antibodies that recognize native gK in virions

    • Recognition by sera from infected animals

  • Functional complementation:

    • Ability to rescue growth defects when expressed in cells infected with gK-null virus

    • Restoration of normal plaque morphology and size

    • Correction of penetration kinetics defects

  • Structural analysis:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to probe tertiary structure

    • If possible, X-ray crystallography or cryo-EM of the purified protein

  • Interaction studies:

    • Co-immunoprecipitation with known interaction partners

    • Surface plasmon resonance to measure binding affinities

    • Yeast two-hybrid or mammalian two-hybrid assays to confirm protein interactions

A multi-faceted validation approach ensures that the recombinant protein accurately represents the native viral protein in structure and function, making it suitable for downstream applications in diagnostics, vaccine development, or structural studies.

How does SHV-1 gK compare functionally to homologous proteins in other herpesviruses?

SHV-1 (Pseudorabies virus) gK functions can be compared with homologous proteins in other herpesviruses:

  • Herpes Simplex Virus-1 (HSV-1) gK:

    • SHV-1 gK is encoded by a gene homologous to HSV-1 UL53, establishing an evolutionary relationship

    • Both proteins are essential for virus replication

    • Both are involved in virus egress from infected cells

    • Both are structural components of the virion envelope

    • HSV-1 gK has been shown to form a functional complex with UL20, which may also be the case for SHV-1 gK

  • Functional similarities across herpesvirus gK proteins:

    • Involvement in viral entry processes

    • Role in cell-to-cell spread

    • Participation in virion assembly and egress

    • Contribution to viral pathogenesis and neurotropism

  • Unique aspects of SHV-1 gK:

    • Important role in preventing immediate reinfection, as evidenced by ultrastructural studies showing nucleocapsids underneath the plasma membrane in gK mutant infections

    • Essential function in virus egress but not entry, based on plating efficiency studies

  • Evolutionary conservation:

    • The functional conservation of gK across alphaherpesviruses suggests it plays fundamental roles in the viral lifecycle

    • Sequence analysis could identify conserved domains likely responsible for core functions versus variable regions that might confer species-specific properties

This comparative analysis provides insights into both universal herpesvirus mechanisms and virus-specific adaptations, potentially informing broad-spectrum antiviral strategies.

What is the potential for using recombinant SHV-1 gK in developing next-generation marker vaccines?

Recombinant SHV-1 gK holds promise for next-generation marker vaccine development based on several considerations:

  • DIVA capability assessment:

    • Current SHV-1 eradication programs use gE-deleted vaccines combined with gE-based diagnostic tests to differentiate infected from vaccinated animals

    • If gK proves immunogenic but non-essential for protection, similar approaches could be developed using gK-deleted vaccines and gK-based diagnostics

    • Alternatively, if gK is essential for immunity, recombinant gK could be incorporated into subunit vaccines

  • Subunit vaccine potential:

    • Preliminary evidence with other glycoproteins suggests that recombinant viral proteins expressed in the baculovirus system can elicit robust immune responses

    • A gK-based subunit vaccine could potentially offer:

      • Enhanced safety compared to attenuated viruses

      • More precise immune targeting

      • Greater stability and ease of production

  • Vector vaccine platforms:

    • Recombinant gK could be expressed in viral vector systems (adenovirus, MVA, etc.)

    • This approach combines the safety of subunit vaccines with the efficiency of viral delivery

    • Multiple antigens could be co-expressed for broader protection

  • Adjuvant optimization:

    • Testing various adjuvant formulations could enhance gK immunogenicity

    • Modern adjuvant platforms might elicit stronger or more balanced immune responses

  • Epitope identification:

    • Mapping immunodominant B-cell and T-cell epitopes in gK could lead to epitope-based vaccines

    • Such vaccines might focus immune responses on protective epitopes while eliminating non-protective or potentially harmful regions

The development of gK-based vaccines would require extensive immunogenicity testing, protection studies in appropriate animal models, and comparison with existing vaccine strategies to demonstrate advantages in efficacy, safety, or DIVA capability.

What emerging technologies might enhance the study and application of recombinant SHV-1 gK?

Several cutting-edge technologies could transform research on recombinant SHV-1 gK:

  • Structural biology advancements:

    • Cryo-electron microscopy for high-resolution structural determination of membrane proteins

    • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

    • AlphaFold and similar AI platforms for structure prediction and design of stabilized variants

  • Genome editing technologies:

    • CRISPR-Cas9 approaches for precise manipulation of the viral genome

    • Base editing for introducing point mutations without double-strand breaks

    • Prime editing for more complex sequence changes with minimal off-target effects

  • Single-cell analysis:

    • Single-cell RNA-seq to study host cell responses to gK and gK mutants

    • Mass cytometry to comprehensively profile immune responses to gK

    • Live-cell imaging to track gK trafficking and interactions in real-time

  • Advanced protein engineering:

    • Directed evolution to develop gK variants with enhanced stability or immunogenicity

    • Design of chimeric glycoproteins incorporating protective epitopes from multiple viral proteins

    • Computational protein design to optimize folding and expression

  • Novel expression platforms:

    • Cell-free protein synthesis systems for rapid production and screening

    • Plant-based expression systems for cost-effective vaccine antigen production

    • Modified yeast strains with humanized glycosylation pathways

  • Advanced imaging:

    • Super-resolution microscopy to visualize gK distribution and trafficking

    • Correlative light and electron microscopy to link functional observations with ultrastructural context

    • Label-free imaging techniques to study native protein in live cells

These technologies could provide unprecedented insights into gK structure-function relationships, host-pathogen interactions, and immune recognition, ultimately leading to improved diagnostic tools and vaccine strategies.

What are the key unanswered questions regarding SHV-1 gK that warrant further investigation?

Despite advances in understanding SHV-1 gK, several important questions remain unanswered:

  • Structural architecture:

    • What is the three-dimensional structure of gK, and how does it compare to homologous proteins?

    • How does glycosylation affect protein conformation and function?

    • What structural changes occur during different phases of viral infection?

  • Protein interactions:

    • Does gK form complexes with other viral proteins, and if so, which ones?

    • What host cell factors interact with gK during different stages of infection?

    • How do these interactions contribute to gK's various functions?

  • Functional mechanisms:

    • What is the molecular basis for gK's role in preventing immediate reinfection?

    • How does gK contribute to viral egress at the molecular level?

    • What domains or residues are critical for specific functions?

  • Immunological aspects:

    • What are the immunodominant B and T cell epitopes in gK?

    • Does gK elicit neutralizing antibodies or primarily cell-mediated responses?

    • How does the immune response to gK contribute to protection versus pathology?

  • Evolutionary considerations:

    • How has gK evolved across different SHV-1 strains and related viruses?

    • Are there strain-specific differences in gK structure or function?

    • Can evolutionary analysis identify conserved functional domains?

  • Therapeutic potential:

    • Could gK serve as a target for antiviral drugs?

    • What are the prospects for gK-based vaccines compared to current approaches?

    • Could gK-specific antibodies have therapeutic applications?

Addressing these questions would significantly advance our understanding of SHV-1 biology and potentially lead to improved control strategies for Aujeszky's disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.