Recombinant Sulcia muelleri ATP-dependent zinc metalloprotease FtsH (ftsH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ftsH; DMIN_00030; ATP-dependent zinc metalloprotease FtsH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-619
Protein Length
full length protein
Species
Sulcia muelleri (strain DMIN)
Target Names
ftsH
Target Protein Sequence
MDKQSKFRIKTFFKKIIFFLIIFCFFYFFNFIKKTKKITHTTQDKFFELLSKNKINKFIV LNKKKVSFTLNEKKSHLDSNNYNFFSKLHLSRYEFEIGDLQLFQKKIDFYKELYEINPNF EFKNYKIYTVLNFFYDYGFFLMIIIICWIFIFRKIASRSSESEFKFKIGKSKAKLYYYNN ITFKDVAGLEGPKEEIKEIVDFLKSPNKYTKLGGKIPKGALLIGPPGTGKTLLAKAVAGE AQVPFFSLSGSDFVEMFVGVGASRVRDLFYIAKLKSPSIIFIDEIDAIGRARIKNNIPGG NDERENTLNKLLTEMDGFSTKTNVIVLAATNRYDVLDDALLRSGRFDRTIFIDLPSLKER KDIMKVHLKKIKFSKSIDLDFISRQIPGFSGADISNICNEAALLAARRNKVKVETKDFID TIYRRIGGIEKKNILIKKNEKKRIAYHETGHAIISWIIEYAHSVFQITITPRGQSLGAAW YIPEERQITTEDQMKDEICTLLGGRAAEYLIFNNKSTGALNDLERITKQAQSMVKFFGLS SLGNISYFDSTGRNDFSLEKAYSEKTSEIIDKEINKIIKEQYKRALEILKKNYDKLIFLA EKLFKKEVLFKEDFASILD
Uniprot No.

Target Background

Function
This recombinant *Sulcia muelleri* ATP-dependent zinc metalloprotease FtsH (ftsH) functions as a processive, ATP-dependent zinc metallopeptidase targeting both cytoplasmic and membrane proteins. It plays a crucial role in the quality control of integral membrane proteins.
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Cytoplasmic side.

Q&A

What is Candidatus Sulcia muelleri and why is it significant in symbiosis research?

Candidatus Sulcia muelleri is an ancient bacterial endosymbiont within the order Bacteroidetes that forms intimate associations with auchenorrhynchous hemipteran insects (leafhoppers, planthoppers, cicadas, etc.). This symbiotic relationship dates back approximately 260-340 million years , making it one of the oldest known bacterial-insect symbioses. Sulcia muelleri is particularly significant because it provides essential amino acids to its insect hosts, complementing their nutritionally deficient plant sap diet.

The symbiont is typically localized in specialized organs called bacteriomes in the insect abdomen, and is maternally transmitted to offspring. In Matsumuratettix hiroglyphicus, a key vector of sugarcane white leaf disease, Sulcia is found in paired, egg-shaped bacteriomes (0.2-0.3 mm) attached to the leafhopper cuticle .

What is the molecular structure and function of ATP-dependent zinc metalloprotease FtsH?

FtsH is a highly conserved ATP-dependent zinc metalloprotease found universally in bacteria, chloroplasts, and mitochondria. Structurally, FtsH forms hexameric complexes composed of two rings:

  • A protease domain ring with an all-helical fold forming a flat hexagon

  • A toroid built by AAA (ATPases Associated with diverse cellular Activities) domains covering the protease ring

The active site of FtsH contains the characteristic HEXXH motif where two histidines coordinate a zinc ion, with an aspartic acid serving as the third zinc ligand (contrary to earlier reports suggesting glutamic acid as the third ligand) . This classifies FtsH as an "Asp-zincin" metalloprotease.

Functionally, FtsH plays crucial roles in:

  • Quality control by degrading unneeded or damaged membrane proteins

  • Targeting specific soluble signaling factors like σ32 and λ-CII

  • Maintaining cellular homeostasis through selective proteolysis

How is recombinant Sulcia muelleri FtsH typically produced for research purposes?

Recombinant Sulcia muelleri FtsH is typically produced in E. coli expression systems. The product specifications typically include:

ParameterSpecification
Protein LengthFull Length (1-619 amino acids)
TagN-terminal His tag
Expression SystemE. coli
FormLyophilized powder
Purity>90% (determined by SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
Storage Conditions-20°C/-80°C, with aliquoting recommended
ReconstitutionIn deionized sterile water to 0.1-1.0 mg/mL
Long-term StorageAddition of 5-50% glycerol recommended

The full amino acid sequence is available for precise experimental design and validation .

What are the key considerations for designing experiments with recombinant Sulcia muelleri FtsH?

When designing experiments involving recombinant FtsH, researchers should apply fundamental principles of experimental design including:

  • Randomization: Assigning treatments randomly to experimental units to eliminate bias

  • Replication: Including multiple independent replicates to estimate experimental error

  • Local control: Controlling for confounding variables

Specific considerations for FtsH experiments include:

  • Appropriate controls: Include negative controls (buffer only), positive controls (known active proteases), and specificity controls (heat-inactivated FtsH)

  • Substrate selection: Choose physiologically relevant substrates or fluorogenic peptides that can detect metalloprotease activity

  • Zinc dependency validation: Include treatments with zinc chelators (EDTA) to confirm metalloprotease activity

  • ATP dependency testing: Compare activity with and without ATP to confirm AAA+ domain functionality

  • Temperature and pH optimization: FtsH from Sulcia muelleri may have optimal activity conditions different from model organisms

What methods are used to study the localization of Sulcia muelleri and its FtsH protein in insect hosts?

Multiple complementary approaches are employed to study Sulcia muelleri localization:

  • Tissue-specific PCR detection:

    • Dissect specific insect organs (gut, salivary gland, ovary, fat body, bacteriome)

    • Extract DNA from each tissue

    • Perform PCR with Sulcia-specific primers

    • Analyze detection rates across tissues

  • Fluorescent in situ hybridization (FISH):

    • Design oligonucleotide probes targeting 16S rRNA (e.g., CBF319 for Bacteroidetes)

    • Apply to tissue sections from adult and nymph insects

    • Use confocal microscopy to visualize localization

    • Combine with transmission electron microscopy for ultrastructural details

Results from these approaches have shown distribution patterns as summarized in this table:

TissueDetection Rate (PCR)FISH Signal Intensity
Bacteriome100% (8/8)Strong, especially at margins
Ovary88% (7/8)Present in reproductive tissues
Gut88% (7/8)Variable
Fat body75% (6/8)Present
Salivary gland0% (0/8)Absent

For FtsH specifically, antibody-based approaches would be required, though these have not been extensively reported in the literature .

How should contradictions in FtsH functional data be addressed methodologically?

When confronting contradictory results in FtsH research, implement this structured approach:

  • Systematic contradiction identification:

    • Document the specific parameters that show contradictory results

    • Evaluate whether contradictions appear in similar experimental contexts

    • Determine if contradictions are statistically significant

  • Methodological reconciliation:

    • Analyze differences in experimental procedures that might explain contradictions

    • Implement threshold-based approaches to determine significance of contradictions

    • Design experiments specifically to test competing hypotheses

  • Validation through multiple techniques:

    • Apply orthogonal methods to study the same parameter

    • Cross-validate findings between in vitro and in vivo systems

    • Use structure-function analysis to resolve mechanistic contradictions

For example, the third zinc ligand in FtsH was initially reported to be glutamic acid based on site-directed mutagenesis, but structural analysis later revealed it to be aspartic acid . This contradiction was resolved through crystal structure determination and additional mutational studies.

What are the critical domains and motifs in Sulcia muelleri FtsH that determine its function?

Sulcia muelleri FtsH contains several critical domains and motifs essential for its function:

  • Transmembrane domains:

    • Typically two N-terminal transmembrane helices (absent in soluble recombinant constructs)

    • Essential for oligomerization and in vivo activity

  • AAA domain:

    • Contains Walker A and B motifs for ATP binding and hydrolysis

    • Second Region of Homology (SRH) with conserved arginine fingers (Arg-318, Arg-321)

    • Central pore with hydrophobic residues (e.g., Phe-234) for substrate engagement

  • Protease domain:

    • HEXXH metalloprotease motif (H423EXXH427 in T. maritima FtsH)

    • Asp-500 as the third zinc ligand

    • Eight α-helices (α11-α18) and a short antiparallel β-ribbon

    • Long, slightly bent α-helix (α16) forming the base of the domain

The molecular architecture suggests a mechanism where ATP hydrolysis drives conformational changes that pull substrate proteins through the central pore toward the proteolytic sites in the interior of the hexamer .

How does ATP hydrolysis couple with the proteolytic function in FtsH?

The coupling mechanism between ATP hydrolysis and proteolysis in FtsH involves:

  • Conformational transmission:

    • ATP binding and hydrolysis induce conformational changes in the AAA domains

    • These changes are transmitted to the central pore lined with hydrophobic residues

    • Rearrangement of the pore residues (e.g., Phe-234) creates a "pulling" motion

  • Sequential processing:

    • ATP is likely hydrolyzed sequentially around the hexameric ring

    • This creates a rotary motion that progressively pulls the substrate through the pore

    • The symmetry mismatch between AAA and protease domains may facilitate this process

  • Substrate presentation:

    • The unfolded substrate is delivered to the proteolytic chamber

    • Zinc-coordinated water molecule activated by the glutamate in the HEXXH motif attacks peptide bonds

    • Degradation products are released through lateral openings

The transmembrane domains likely serve as "elastic springs" that constrain the movement of AAA domains, preventing them from being locked in intermediate conformations and ensuring proper coupling between ATP hydrolysis and proteolysis .

What assays can be used to measure the enzymatic activity of recombinant Sulcia muelleri FtsH?

Several complementary assays can be employed to characterize FtsH activity:

  • Caseinolytic assays:

    • Use fluorescently labeled casein as a general protease substrate

    • Monitor increase in fluorescence as casein is degraded

    • Compare activity with and without ATP to confirm ATP dependency

  • ATPase activity assays:

    • Measure phosphate release using malachite green assay

    • Monitor ADP production using coupled enzyme assays

    • Determine Km and Vmax for ATP hydrolysis

  • Model substrate degradation:

    • Use known FtsH substrates (e.g., σ32, λ-CII)

    • Monitor degradation via SDS-PAGE and western blotting

    • Calculate degradation rates under various conditions

  • FRET-based assays:

    • Design peptides with fluorophore and quencher flanking FtsH cleavage sites

    • Monitor increase in fluorescence upon cleavage

    • Use for high-throughput screening of conditions or inhibitors

When measuring activity, it's crucial to validate that observed proteolysis is indeed FtsH-dependent by including controls with specific inhibitors (zinc chelators for the protease domain and ATPase inhibitors for the AAA domain).

How is Sulcia muelleri being investigated for potential control of sugarcane white leaf disease?

Sulcia muelleri is being evaluated as a candidate for symbiotic control of sugarcane white leaf (SCWL) disease through several research approaches:

  • Vector-symbiont relationship characterization:

    • Identifying Sulcia as a consistent symbiont in Matsumuratettix hiroglyphicus

    • Determining tissue distribution and transmission patterns

    • Confirming vertical transmission from mother to offspring

  • Symbiont manipulation potential:

    • Evaluating Sulcia as a potential paratransgenic vehicle

    • Comparing Sulcia with other symbionts (e.g., BAMH) for specificity to disease vectors

    • Assessing stability of the symbiotic relationship across generations

The rationale for using Sulcia includes:

  • Its presence in bacteriomes and reproductive tissues

  • High prevalence in leafhopper populations (nearly 100% in bacteriomes)

  • Vertical transmission ensuring persistence in vector populations

What methods are used to study the transmission of Sulcia muelleri between insect generations?

Researchers employ multiple complementary approaches to study vertical transmission:

  • Developmental stage analysis:

    • PCR detection in eggs, different nymphal instars, and adults

    • Quantitative PCR to measure symbiont titers across development

  • Reproductive tissue imaging:

    • FISH to visualize Sulcia in ovaries, oviducts, and embryos

    • Transmission electron microscopy to observe symbiont invasion of oocytes

  • Transmission route characterization:

    • Comparative analysis of different insect lineages

    • Documentation of alternative transmission patterns

Research has revealed two distinct transmission patterns:

  • In most species, all nutritional symbionts (including Sulcia) simultaneously infect the posterior end of full-grown oocytes and gather in the perivitelline space

  • In other species, Sulcia forms a "symbiont ball" that invades late, separate from other symbionts that colonize the anterior pole of young oocytes

These different transmission strategies represent alternative evolutionary solutions to the challenge of establishing heritable symbiosis .

How can phylogenomic approaches enhance our understanding of FtsH evolution in symbiotic bacteria?

Phylogenomic approaches offer powerful tools for understanding FtsH evolution:

  • Comparative genomic analysis:

    • Compare FtsH sequences across Sulcia strains from different host lineages

    • Identify selection signatures (dN/dS ratios) in different domains

    • Correlate FtsH evolution with host phylogeny

  • Molecular clock applications:

    • Estimate divergence times of FtsH variants

    • Compare evolutionary rates between FtsH and other essential genes

    • Correlate with the estimated age of symbiotic associations (260-340 million years)

  • Structural phylogenetics:

    • Model the impact of sequence variations on protein structure

    • Identify conserved vs. variable regions in the 3D structure

    • Correlate structural changes with functional adaptations

  • Metabolic context analysis:

    • Analyze FtsH function in the context of Sulcia's reduced metabolic network

    • Compare with co-symbionts to identify complementary functions

    • Assess correlation between FtsH evolution and genome reduction events

Such approaches could reveal how FtsH has adapted to the symbiotic lifestyle while maintaining its essential functions, potentially identifying unique features that could be targeted for symbiont control strategies.

What potential applications exist for using FtsH as a target for symbiont management strategies?

FtsH represents a promising target for symbiont management due to several characteristics:

  • Essential function:

    • FtsH is critical for bacterial survival

    • Targeting FtsH could disrupt symbiont viability without direct insect toxicity

  • Specific targeting approaches:

    • Design inhibitors specific to Sulcia FtsH unique features

    • Develop antisense or RNAi constructs targeting ftsH mRNA

    • Engineer competitive substrate analogs that block the central pore

  • Delivery mechanisms:

    • Exploit the natural transmission routes of Sulcia

    • Use paratransgenesis to introduce modified Sulcia expressing altered FtsH

    • Develop ingested compounds that accumulate in bacteriomes

  • Monitoring effectiveness:

    • Measure FtsH activity in field populations as a biomarker

    • Track symbiont titers and transmission efficiency

    • Assess impact on vector competence for phytoplasma transmission

Such approaches could provide more environmentally sustainable alternatives to chemical insecticides for controlling vectors of sugarcane white leaf disease and potentially other insect-transmitted plant diseases.

What are the methodological challenges in studying FtsH function in obligate symbionts like Sulcia muelleri?

Researching FtsH in obligate symbionts presents several significant challenges:

  • Cultivation limitations:

    • Sulcia muelleri cannot be cultured outside its host

    • Requires insect rearing facilities for symbiont access

    • Difficulty separating symbiont effects from host physiology

  • Genetic manipulation barriers:

    • No established transformation systems for Sulcia

    • Limited ability to perform classical genetic studies

    • Difficulty creating targeted mutants

  • Biochemical constraints:

    • Challenges in obtaining sufficient pure material

    • Potential loss of function during purification

    • Need for host factors for proper function

  • Functional validation:

    • Difficulty confirming in vivo function of recombinant proteins

    • Limited ability to complement genetic defects

    • Challenges in observing direct effects of manipulation

Overcoming these challenges may require:

  • Development of cell-free expression systems with Sulcia components

  • Host microinjection techniques for delivering modified components

  • Advanced microscopy approaches for visualizing protein-protein interactions in intact bacteriomes

  • Systems biology approaches integrating -omics data to infer function

These methodological innovations would substantially advance our ability to study this important protease in its native symbiotic context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.