Recombinant Sulfate transport system permease protein CysW (cysW)

Shipped with Ice Packs
In Stock

Description

Functional Role in Sulfate Transport

CysW is indispensable for sulfate uptake under sulfur-limiting conditions:

  • Mechanism: Forms a channel with CysT to translocate sulfate/thiosulfate into the cytoplasm, powered by CysA-mediated ATP hydrolysis .

  • Mutant studies: Disruption of cysW in Synechococcus sp. PCC 7942 abolished sulfate uptake, rendering cells nonviable in sulfate-dependent growth .

  • Substrate specificity: Transports sulfate (K<sub>m</sub> = 0.1–36 μM) and thiosulfate, depending on periplasmic binding proteins (Sbp or CysP) .

Essentiality in Pathogens

In M. tuberculosis, the CysTWA complex is vital for sulfur acquisition, though Rv1739c (a SulP protein) enhances sulfate uptake only in the presence of functional CysA . Deletion of cysA or cysW disrupts sulfate transport, impairing survival in sulfur-scarce environments .

Biotechnological Applications

Recombinant CysW is commercially produced for research:

SupplierCatalog No.Source OrganismPrice (USD)Tag
MyBioSource.comN/AE. coli1,595His-tag
Creative BiomartRFL19351EFE. coliQuote-basedN-terminal His
Colorectal ResearchN/ASynechocystis sp.1,626Variable

Regulatory and Evolutionary Context

  • Operon organization: cysW is often part of the cysPTWA operon, co-regulated by sulfur availability via LysR-family transcription factors .

  • Evolution: ABC-type sulfate transporters (SulT family) are conserved in Gram-negative bacteria, whereas SulP-family proteins like Rv1739c supplement transport in Actinobacteria .

Future Directions

  • Structural studies: High-resolution crystallography of CysW-CysT complexes could elucidate channel gating mechanisms.

  • Drug targeting: Inhibiting CysW in pathogens like M. tuberculosis may disrupt sulfur metabolism, offering therapeutic avenues .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
cysW; c2957; Sulfate transport system permease protein CysW
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
cysW
Target Protein Sequence
MAEVTQLKRYDARPINWGKWFLIGIGMLVSAFILLVPMIYIFVQAFSKGLMPVLQNLADP DMLHAIWLTVMIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLV YLLFYGSNGPLGGWLDEHNLQIMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAA ILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIE LLEQDYNTVGSFTAAALLTLMAIITLFLKSMLQWRLENQEKRAQQEEHHEH
Uniprot No.

Target Background

Function
CysW is a component of the ABC transporter complex CysAWTP (TC 3.A.1.6.1), which plays a role in sulfate/thiosulfate import. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: ecc:c2957

STRING: 199310.c2957

Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Sulfate transport system permease protein CysW and what is its function?

CysW is an integral membrane component of the ABC-type sulfate transport system found in various bacteria, including Escherichia coli, Mycobacterium tuberculosis, and cyanobacteria. It functions as a transmembrane channel protein that facilitates the movement of sulfate ions across the cytoplasmic membrane. As part of the sulfate transport complex, CysW works in conjunction with other proteins (CysT, CysA, CysP, and Sbp) to form a complete functional transport system .

Studies with mutant strains have demonstrated that when the cysW gene is interrupted by a drug resistance marker, organisms become non-viable when grown with sulfate as the sole sulfur source and exhibit essentially no sulfate uptake . This confirms the essential role of CysW in sulfate acquisition and subsequent metabolism.

How is CysW structurally organized within the sulfate transport system?

The sulfate transport system containing CysW belongs to the ATP-binding cassette (ABC) transporter family. In E. coli, this system consists of:

  • Membrane components: CysT, CysW, and CysA proteins

  • Periplasmic binding proteins: CysP and Sbp proteins

CysW and CysT are believed to form the transmembrane channel through which sulfate ions pass, while CysA provides the energy for transport through ATP hydrolysis . The full-length CysW protein from Synechocystis sp. consists of 276 amino acids with multiple hydrophobic regions that form transmembrane segments .

The transport mechanism follows the typical ABC transporter model:

  • Substrate binding by periplasmic proteins

  • Transfer to the membrane channel formed by CysW and CysT

  • Energy-dependent translocation across the membrane powered by ATP hydrolysis by CysA

How is the expression of cysW regulated in bacterial systems?

The expression of cysW and other genes involved in sulfate transport is regulated primarily by sulfur availability. In cyanobacteria like Synechococcus sp. strain PCC 7942, these genes are sulfur-regulated, with expression increasing under sulfur-limiting conditions .

In Mycobacterium tuberculosis, Rv2398c (which encodes CysW) is predicted to be co-regulated in specific gene modules (bicluster_0462 with residual 0.49 and bicluster_0518 with residual 0.50) . These co-regulation patterns suggest complex regulatory networks that control CysW expression in response to environmental conditions.

A regulatory gene, cysR, located between cysT and cysW in Synechococcus sp., encodes a polypeptide with homology to a family of prokaryotic regulatory proteins, indicating a potential role in the regulation of the sulfate transport system .

How does CysW contribute to substrate specificity in the transport system?

While primarily associated with sulfate transport, the CysW-containing transport system also facilitates the uptake of other ions. Research has shown that in E. coli, tellurate enters cells via the CysPUWA sulfate transporter, contributing to tellurate toxicity . This substrate versatility suggests that CysW and its associated proteins recognize structural features common to both sulfate and tellurate ions.

The ability of the transport system to handle multiple substrates may reflect evolutionary adaptations that allow bacteria to utilize alternative anions when preferred substrates are unavailable, or it may represent an unintended consequence of structural similarities between these ions.

How do genetic variations in cysW affect bacterial fitness and sulfate transport?

Genetic variations in cysW can significantly impact sulfate transport efficiency and bacterial fitness. Studies have shown that:

Genetic StatusObserved PhenotypeReference
Wild-type cysWNormal growth with sulfate as sole sulfur source
cysW knockout/interruptionUnable to grow with sulfate as sole sulfur source
Single cysP or sbp mutants with intact cysWAble to utilize both sulfate and thiosulfate
Double mutations of cysP and sbp with intact cysWCysteine auxotrophy

These findings demonstrate that CysW is essential for sulfate utilization and that genetic variations affecting its function can have profound effects on bacterial metabolism and survival under different environmental conditions.

What expression systems are most effective for producing functional recombinant CysW?

E. coli is commonly used as an expression host for recombinant CysW production, as demonstrated for Synechocystis sp. CysW . The recombinant protein can be expressed with tags (commonly His-tag) to facilitate purification.

For optimal expression of functional CysW, researchers should consider:

  • Expression vector selection with appropriate promoters

  • Codon optimization based on the expression host

  • Growth conditions (temperature, induction time, media composition)

  • Solubilization strategies using appropriate detergents

  • Purification protocols that maintain protein stability and function

The recombinant protein can be supplied in various forms, such as lyophilized powder reconstituted in appropriate buffers containing stabilizing agents like trehalose .

What techniques are most effective for studying CysW function in sulfate transport?

Several complementary approaches can be used to study CysW function:

  • Genetic approaches:

    • Gene knockout/interruption studies to assess the impact on growth and sulfate utilization

    • Site-directed mutagenesis to identify essential residues

    • Complementation assays to confirm gene function

  • Biochemical approaches:

    • Sulfate uptake assays using radioactive tracers

    • Reconstitution of purified protein into liposomes for transport studies

    • Binding assays to characterize interactions with substrates and other proteins

  • Structural approaches:

    • Protein crystallography or cryo-EM to determine three-dimensional structure

    • Computational modeling based on homologous proteins

    • Cross-linking studies to identify protein-protein interactions

How can researchers design effective mutagenesis studies to identify critical residues in CysW?

Successful mutagenesis studies of CysW require a systematic approach:

  • Compare CysW sequences across different organisms to identify conserved residues

  • Use topology prediction tools to map residues to transmembrane regions

  • Target conserved residues in predicted substrate-binding sites or protein-protein interaction interfaces

  • Employ both alanine-scanning mutagenesis and directed mutations based on chemical properties

  • Develop functional assays to assess the impact of mutations on transport activity

  • Use complementation assays in cysW-deficient strains to confirm the functionality of mutated proteins

Mutations in CysW that affect transport activity but not protein stability or membrane insertion can help identify residues directly involved in substrate recognition or transport.

CysW in Different Biological Systems

Research in the green algae Scenedesmus acutus has demonstrated connections between sulfate transport systems and chromium tolerance . While this study focused on SULTRs (H+/SO4²⁻ transporters) rather than CysW specifically, it highlights the importance of sulfate acquisition systems in metal stress responses.

The link between sulfate transport and metal tolerance may involve:

  • Increased demand for sulfur-containing compounds (like glutathione) for metal detoxification

  • Differential regulation of high and low-affinity transporters affecting metal uptake

  • Competition between metals and sulfate for transport

  • Structural changes in transporters affecting ion specificity

In S. acutus, chromium-tolerant strains showed different regulation of sulfate transporters compared to wild-type strains, with the chromium-tolerant strain maintaining higher expression of certain transporters during chromium exposure .

What is the evolutionary significance of CysW in bacterial sulfate metabolism?

The conservation of CysW across diverse bacterial lineages suggests an ancient evolutionary origin for this component of the sulfate transport system. Notably, three of the sulfur-regulated genes in cyanobacteria (including genes similar to cysW) have homologs encoded by the chloroplast genome of the primitive plant Marchantia polymorpha .

This evolutionary relationship provides support for:

  • The endosymbiotic theory of chloroplast evolution

  • The conservation of essential sulfate transport mechanisms across prokaryotes and eukaryotic organelles

  • The fundamental importance of sulfate acquisition for cellular metabolism

The presence of similar sulfate transport systems in chloroplasts suggests that the mechanism established in ancient cyanobacteria was maintained during the evolution of photosynthetic eukaryotes, highlighting its essential nature.

How can CysW be used as a target for developing antimicrobial agents?

Given the essential role of CysW in sulfate acquisition, particularly in organisms like Mycobacterium tuberculosis , it represents a potential target for antimicrobial development. Strategies might include:

  • Designing small molecules that block the sulfate channel formed by CysW and CysT

  • Developing compounds that disrupt interactions between CysW and other components of the transport system

  • Creating inhibitors that compete with sulfate for binding but cannot be transported

  • Exploiting the dual specificity of the transporter to deliver toxic compounds into bacterial cells

The development of such antimicrobials would require detailed structural and functional characterization of CysW and its interactions, combined with high-throughput screening for potential inhibitors.

What methodological advances could improve our understanding of CysW structure and dynamics?

Several emerging technologies could enhance our understanding of CysW:

  • Advanced structural biology techniques:

    • High-resolution cryo-electron microscopy to determine the structure of the complete transport complex

    • Single-particle analysis to capture different conformational states during transport

    • Time-resolved structural studies to track the transport cycle

  • Computational approaches:

    • Molecular dynamics simulations to model CysW behavior in membrane environments

    • Machine learning algorithms to predict structure-function relationships

    • Quantum mechanics calculations to understand the energetics of ion transport

  • Novel imaging approaches:

    • Super-resolution microscopy to visualize CysW distribution and dynamics in live cells

    • Single-molecule tracking to follow individual transport events

    • Correlative light and electron microscopy to connect function with structure

How might CysW research contribute to sustainable biotechnology applications?

Understanding CysW and sulfate transport has potential applications in:

  • Bioremediation: Engineered bacteria with modified CysW proteins could be developed for enhanced uptake of environmental pollutants like tellurate .

  • Sustainable agriculture: Improving sulfur uptake in beneficial soil bacteria could enhance plant nutrition and reduce the need for fertilizers.

  • Biosensors: CysW-based systems could be developed to detect and monitor sulfate and related compounds in environmental samples.

  • Synthetic biology: Engineering sulfate transport systems with novel specificities could create microorganisms with unique metabolic capabilities for industrial applications.

These applications would require detailed understanding of CysW structure-function relationships and the ability to engineer the protein for specific purposes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.