Recombinant Sulfolobus acidocaldarius Membrane-associated ATPase C chain (atpP)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

The atpP gene encodes the C chain of the membrane-associated ATPase in S. acidocaldarius. Key structural features include:

AttributeDetails
Gene NameatpP (SACI_RS07395, SACI_1552)
UniProt IDQ4J8L5
Amino Acid SequenceMRKALLISLILPILIGGLVAAAQAPQDTPQGFMGINIGAGLAVGLAAIGAGVAVGTAAAA GIGVLTEKREMFGTVLIFVAIGEGIAVYGIIFAVLMLFAGI (101 residues)
Molecular Weight~11.1 kDa (calculated for 101 residues; His-tag adds ~1.5 kDa)
Subcellular LocalizationMembrane-associated ATP synthase complex

The protein shares limited sequence homology with eubacterial F1-ATPase subunits but exhibits structural similarity to the proteolipid subunit (F0) of proton-translocating ATP synthases .

Functional Characteristics and Research Findings

The atpP protein is integral to the ATP synthase complex in S. acidocaldarius, enabling energy transduction via proton gradients:

Biochemical Properties

PropertyObservation
Substrate SpecificityHydrolyzes ATP, GTP, CTP, and UTP; no activity on ADP or pyrophosphate
InhibitorsNitrate (IC₅₀ = 8 mM), but resistant to DCCD, azide, and vanadate
Thermal StabilityLinear Arrhenius plots up to 75°C, reflecting adaptation to high-temperature environments

Role in Energy Transduction

  • Proton Motive Force (PMF): ATP synthesis is coupled to PMF generation (140–160 mV under respiratory conditions) .

  • Reversibility: Functions bidirectionally, acting as an ATP synthase during oxidative phosphorylation and an ATPase under energy surplus .

Applications in Research

The recombinant atpP serves as a model for studying extremophilic ATPases and energy transduction mechanisms:

ApplicationDetails
Structural BiologyX-ray crystallography to resolve membrane-bound ATP synthase architecture
Enzyme KineticsATP hydrolysis assays to probe catalytic mechanisms under extreme pH/temperature
Biotechnological ToolsDevelopment of thermostable enzymes for industrial processes

References

  1. MyBioSource. Recombinant Sulfolobus acidocaldarius Membrane-associated ATPase C chain (atpP). Product Page .

  2. Schäfer, G., et al. Chemiosmotic energy conversion of the archaebacterial ATP synthase. PMID: 210478 .

  3. Creative Biomart. Recombinant Full Length Sulfolobus Acidocaldarius Membrane-Associated Atpase C Chain(Atpp) Protein, His-Tagged. Product Page .

  4. Denda, K., et al. The membrane-associated ATPase from Sulfolobus acidocaldarius is distantly related to F1-ATPase. PubMed .

  5. Lübben, M., et al. A plasma-membrane associated ATPase from the thermoacidophilic archaebacterium Sulfolobus acidocaldarius. PubMed .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for the specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpP; Saci_1552; Membrane-associated ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Target Names
atpP
Target Protein Sequence
MRKALLISLILPILIGGLVAAAQAPQDTPQGFMGINIGAGLAVGLAAIGAGVAVGTAAAA GIGVLTEKREMFGTVLIFVAIGEGIAVYGIIFAVLMLFAGI
Uniprot No.

Target Background

Function
The C chain is a proteolipid and one of the membranous subunits of the non-enzymatic component of the Sul-ATPase complex.
Database Links
Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sulfolobus acidocaldarius and why is its ATPase of particular interest?

Sulfolobus acidocaldarius is a thermoacidophilic archaebacterium (specifically a Crenarchaeon) that has gained significant research interest due to its phylogenetic distance from eubacteria and eukaryotes, as well as its remarkable adaptation to extreme environments. This organism grows optimally at 76°C and pH 3, conditions that would denature most proteins from mesophilic organisms . The membrane-associated ATPase from S. acidocaldarius is particularly interesting because it offers crucial insights into the energy-converting mechanisms that enable survival under these harsh conditions and provides a key to understanding the evolutionary position of these unusual microorganisms .

What are the basic biochemical properties of the S. acidocaldarius membrane-associated ATPase?

The membrane-associated ATPase from S. acidocaldarius exhibits specific activities of 0.3-0.6 μmol min⁻¹ (mg protein)⁻¹ and displays two pH optima at 5.5 and 8.0 under standard conditions. When activated by sulfite, this profile changes to display a single optimum at pH 6.25. The enzyme requires divalent cations (specifically Mg²⁺ or Mn²⁺) for optimal activity, during which it hydrolyzes ATP with highest reactivity. It can also hydrolyze other purine and pyrimidine nucleotides but shows no activity toward ADP and pyrophosphate. Unlike many other ATPases, this enzyme is not inhibited by classic inhibitors such as N,N'-dicyclohexylcarbodiimide, azide, or vanadate .

How does the structure of S. acidocaldarius ATPase compare to other ATPases?

The solubilized S. acidocaldarius ATPase, as analyzed through activity staining in non-denaturing gels and subsequent sodium dodecyl sulfate electrophoresis, reveals a composition of two major polypeptides with molecular weights of 65 kDa and 51 kDa. These subunits bear striking resemblance to the alpha and beta subunits commonly found in eubacterial and eukaryotic F₀F₁-ATPases, suggesting evolutionary conservation of certain structural elements despite the vast phylogenetic distance between archaea and other domains of life .

How does the S. acidocaldarius ATPase C chain (atpP) contribute to thermostability?

The atpP component of S. acidocaldarius ATPase plays a critical role in maintaining structural integrity at high temperatures. Research indicates that the enzyme demonstrates linear Arrhenius plots up to 75°C, reflecting pronounced adaptation to the hot environment in which the archaebacterium thrives . This thermostability likely stems from several molecular adaptations, including increased hydrophobic interactions, enhanced ionic bonding patterns, and specific amino acid substitutions that favor protein stability at elevated temperatures. The C chain specifically contributes to this thermostability through its participation in the membrane-embedded portion of the complex, where it helps anchor the catalytic components and maintain proper conformational states under thermal stress.

What role does the S. acidocaldarius ATPase play in bioenergetics under acidic conditions?

The S. acidocaldarius ATPase is suggested to function as a reversibly acting ATP synthase responsible for oxidative phosphorylation in this organism . What makes this particularly interesting is that the enzyme must function at both extreme temperatures and highly acidic conditions simultaneously. Current research indicates that the enzyme leverages the natural pH gradient across the archaeal membrane (acidic outside, more neutral inside) as part of its energy-coupling mechanism. The atpP chain, as part of the membrane-embedded F₀ sector of the ATPase, likely participates in proton translocation across this extreme pH gradient, effectively converting the energy stored in this gradient into ATP synthesis under appropriate conditions.

What are the optimal conditions for expressing recombinant S. acidocaldarius ATPase C chain?

For successful expression of functional recombinant S. acidocaldarius ATPase C chain (atpP), several methodological considerations must be addressed. The extreme thermophilic origin of this protein presents challenges for heterologous expression in mesophilic host systems. Expression in E. coli systems typically requires codon optimization and careful temperature control during induction. Post-induction at temperatures between 18-25°C for extended periods (16-24 hours) often yields better results than standard 37°C protocols. Additionally, the use of specialized E. coli strains capable of providing rare codons can significantly improve expression yields. For purification, heat treatment (65-70°C for 15-20 minutes) as an initial step can exploit the thermostable nature of atpP to eliminate many host proteins while retaining activity of the target protein.

How can genetic manipulation techniques be applied to study atpP function in vivo?

Recent advances in genetic tools for S. acidocaldarius have enabled sophisticated in vivo studies of atpP function. A versatile genetic system has been developed based on uracil auxotrophy, which allows for markerless deletion mutants, genomic tagging of genes, and integration of foreign DNA . For atpP-specific studies, several approaches can be employed:

  • Markerless deletion mutants can be created using the "pop in/pop out" method based on pyrE selection

  • Site-directed mutagenesis can be performed to study specific residues

  • Genomic tagging can enable pull-down experiments for protein complex studies

  • Ectopic integration of modified atpP variants can allow for complementation studies

These techniques typically utilize a S. acidocaldarius pyrE deletion mutant (such as MW001) as the starting point, which can be transformed with various constructs containing appropriate homologous flanking regions to target the desired genomic location .

How should enzymatic activity data be normalized and compared between wild-type and recombinant atpP?

When comparing enzymatic activity between wild-type and recombinant S. acidocaldarius ATPase C chain (atpP), several normalization approaches should be considered. The table below outlines recommended normalization methods and their appropriate applications:

Normalization MethodApplicationAdvantagesLimitations
Specific Activity (μmol min⁻¹ mg⁻¹)Standard comparison between enzyme preparationsDirect comparison with literature values (0.3-0.6 μmol min⁻¹ mg⁻¹)Requires accurate protein quantification
Turnover Number (kcat)Comparing catalytic efficiencyAccounts for molecular weight differencesRequires pure enzyme preparations
Relative Activity (%)Comparing effects of mutations/conditionsSimple presentation for multiple conditionsCannot determine absolute activity differences
Arrhenius PlotsThermostability analysisCan detect subtle changes in activation energyRequires measurements across temperature range (up to 75°C)

For wild-type vs. recombinant comparisons, activity should be measured under identical conditions, with particular attention to the two pH optima (5.5 and 8.0) and in the presence of the appropriate divalent cations (Mg²⁺ or Mn²⁺). Additional measurements in the presence of sulfite can provide insights into activation mechanisms that shift the pH optimum to 6.25 .

What technical challenges should researchers anticipate when working with membrane-associated proteins from extremophiles?

Researchers working with membrane-associated proteins like atpP from extremophiles face several technical challenges. First, maintaining native-like environments during extraction and purification is essential for preserving function. Traditional detergent-based extraction methods may disrupt critical lipid-protein interactions. Second, temperature stability during experimental procedures requires careful consideration—while the protein itself is thermostable, complete complexes may have different thermal properties than individual subunits. Third, reconstitution experiments to study function often require extremophilic lipids or lipid analogs that can withstand elevated temperatures and acidic conditions.

Additionally, when conducting heterologous expression of atpP, proper folding and assembly can be problematic in mesophilic hosts. Co-expression with chaperones or other ATPase subunits may be necessary to obtain functional protein. Finally, standard activity assays may require modification to function under the extreme conditions where these proteins naturally operate, including buffers stable at low pH and high temperature.

How might recombinant S. acidocaldarius atpP be utilized in synthetic biology applications?

The unique properties of S. acidocaldarius ATPase C chain make it a valuable component for synthetic biology applications requiring extremophilic capabilities. Potential applications include:

  • Development of thermostable ATP-regenerating systems for high-temperature biocatalysis

  • Creation of minimal synthetic cells capable of energy transduction under extreme conditions

  • Engineering of hybrid energy-transducing complexes with enhanced stability

  • Development of biosensors functional in harsh industrial environments

The genetic tools recently developed for S. acidocaldarius provide a framework for such applications. The ability to perform markerless deletions, genomic tagging, and ectopic integration of foreign DNA makes S. acidocaldarius an increasingly suitable host for synthetic biology approaches . The copper-inducible promoter system mentioned in the literature could provide controlled expression of atpP constructs, facilitating precise regulation in synthetic systems.

What evolutionary insights can be gained from comparative studies of ATPase C chains across archaeal species?

Comparative studies of ATPase C chains across different archaeal species, particularly those adapted to various extreme environments, can provide valuable insights into both evolutionary history and adaptation mechanisms. The S. acidocaldarius ATPase structure, with its reminiscence to the alpha and beta subunits of eubacterial and eukaryotic F₀F₁-ATPases despite vast phylogenetic distance, suggests deep evolutionary conservation of energy-converting systems .

Through sequence alignment, structural modeling, and functional studies of atpP variants from different archaeal species, researchers can identify conserved domains essential for basic function versus variable regions that may contribute to specific environmental adaptations. Such analysis may reveal how these enzymes have evolved to maintain similar catalytic functions while adapting to diverse extreme conditions including high temperature, acidity, salinity, or pressure. This evolutionary perspective could significantly contribute to our understanding of the origin and diversification of life's energy-transducing systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.