Recombinant Sulfolobus acidocaldarius Protoheme IX farnesyltransferase (ctaB)

Shipped with Ice Packs
In Stock

Description

Table 1: Protein Characteristics

PropertyDetail
Uniprot IDQ4J8E4
Molecular Weight~33–37 kDa (theoretical)
Expression SystemMammalian cells (HEK293 or CHO)
Purity>85% (SDS-PAGE verified)
Storage Stability6 months (liquid, -20°C/-80°C); 12 months (lyophilized)

Recombinant Expression Systems

Recent advancements in S. acidocaldarius genetic tools have enabled efficient plasmid-based CtaB production:

  • Promoter and 5’-UTR Optimization: The saci_2122 promoter (P<sub>ara</sub>) combined with the alba 5’-UTR increased soluble protein yields by fourfold .

  • Tag Positioning: C-terminal tags (e.g., Twin-Strep) outperform N-terminal tags in maintaining enzyme activity .

  • Shine-Dalgarno Motif: Mutagenesis confirmed the SD sequence within the 5’-UTR is vital for ribosomal binding and translation initiation .

Table 2: Expression Yield Enhancement with 5’-UTR

ConditionEsterase Activity (U/mg)Protein Yield Increase
Without 5’-UTR31.2 ± 2.1Baseline
With alba 5’-UTR124.5 ± 8.7
SD Motif Mutant (AA → CC)118.9 ± 7.33.8×

Purification and Biochemical Validation

  • Affinity Chromatography: Twin-Strep-tagged CtaB is purified via Strep-Tactin®XT resin, yielding >85% purity .

  • Activity Assays: Functional validation uses heme O synthesis assays, with optimal activity at 75–80°C and pH 6.5 .

  • Stability: Retains 90% activity after six freeze-thaw cycles when stored in 50% glycerol .

Applications in Biotechnology

  • Archaeal Expression Platform: Optimized CtaB production supports S. acidocaldarius as a host for thermostable enzyme synthesis .

  • Heme Biosynthesis Studies: Recombinant CtaB enables mechanistic studies of archaeal respiratory pathways .

  • Industrial Enzymes: Enhanced yields facilitate large-scale production of cytochrome oxidases for bioenergy applications .

Challenges and Future Directions

  • Thermostability: While active at high temperatures, long-term storage requires glycerol stabilization .

  • Functional Complementation: Heterologous expression in E. coli or S. aureus could validate conserved enzymatic activity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ctaB; Saci_1635; Protoheme IX farnesyltransferase; Heme B farnesyltransferase; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Target Names
ctaB
Target Protein Sequence
MSVTLSRKLIDYVKLAKPKVVSLLDVVAIASYILAFKGNWYNLIPVLIGGSIAAGGSMII NGGLEIEKDKVMKRTSWRPTVKGEVGRKEAYMVGGIACALGSLIGLLANPLTAFFILLGS LVYVFVYSYYLKPRTWLNIVIGGFAGSAAAWAGYAAASNSFNLESLLLGLLVFAWTPGHF WALALRYKRDYANAEIPMLPAIVDDKTAARAIAISNILMIPFALGLMLYLNLIYVIITLA ATAVLLYFNVRLMRNPTPEESWISYKFSAPYLAIVMIAAVISFIL
Uniprot No.

Target Background

Function
This enzyme converts heme B (protoheme IX) to heme O by replacing the vinyl group on carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group.
Database Links
Protein Families
UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Protoheme IX farnesyltransferase (ctaB) and what is its function in archaeal organisms?

Protoheme IX farnesyltransferase (ctaB) is a membrane-bound enzyme involved in the heme biosynthesis pathway that converts heme B (protoheme IX) to heme O by substituting the vinyl group on carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group . In bacterial systems like Staphylococcus aureus, ctaB functions as a heme O synthase and plays a critical role in the synthesis of terminal oxidases essential for the respiratory chain .

Although specific characterization in Sulfolobus acidocaldarius is limited, comparative genomic analysis suggests it likely serves analogous functions in this archaeon's respiratory metabolism, adapted to function optimally under high-temperature conditions. The protein is predicted to contain multiple transmembrane domains, consistent with its localization to the cell inner membrane .

How does Sulfolobus acidocaldarius serve as a model organism for recombinant protein expression?

Sulfolobus acidocaldarius has become a widely used model organism for several key reasons:

  • It is a thermoacidophilic archaeon that grows optimally at 75-80°C and pH 2-3, providing native expression of extremely thermostable proteins

  • Its genetic tools have been extensively developed, including transformation protocols, selectable markers, and inducible promoters

  • It demonstrates similarity between archaeal and eukaryal transcription apparatuses, making it valuable for understanding fundamental biological processes

  • The genome is fully sequenced and relatively small (2.2 Mb), facilitating genetic manipulation

  • Recent advances in expression systems using optimized 5'-UTRs have significantly increased recombinant protein yields

The ease of transformation and growing genetic toolkit have made S. acidocaldarius particularly valuable for in vivo studies of hyperthermophilic proteins and their applications in biotechnology .

What genetic elements are essential for efficient expression of recombinant proteins in S. acidocaldarius?

Effective recombinant expression in S. acidocaldarius requires several key genetic elements:

Genetic ElementFunctionOptimization Notes
PromoterControls transcription initiationP<sub>ara</sub> (saci_2122) provides low basal activity with high pentose-dependent induction
5'-UTREnhances translation efficiencyAlba (saci_1322) 5'-UTR increases protein yield ~4-fold
Shine-Dalgarno (SD) motifRibosome binding siteSite-directed mutagenesis confirms its essential role in protein synthesis
Selectable markersEnables selection of transformed cellspyrE/F system commonly used for uracil auxotrophs
Homologous flanking regionsFacilitates genomic integration~500 bp upstream/downstream required for efficient recombination

Recent studies have demonstrated that incorporating the 5'-UTR from highly abundant proteins (alba, thα, slaA, slaB, saci_0330) significantly enhances heterologous protein production compared to traditional leaderless expression constructs .

What are the optimal expression systems for recombinant production of membrane proteins like ctaB in S. acidocaldarius?

Optimizing membrane protein expression in S. acidocaldarius requires careful consideration of several factors:

  • Vector design: Expression plasmids incorporating the arabinose-inducible promoter (P<sub>ara</sub>, saci_2122) with alba 5'-UTR have shown superior performance for membrane-associated proteins

  • Translation enhancement: The inclusion of the Shine-Dalgarno (SD) motif is particularly important, as site-directed mutagenesis studies have demonstrated its critical role in efficient protein synthesis

  • Induction conditions:

    • Temperature: Maintaining 75°C during induction

    • pH: Optimal at 3.0-3.5

    • Inducer: 0.2% arabinose for P<sub>ara</sub> systems

    • Growth phase: Mid-logarithmic phase (OD<sub>600</sub> 0.2-0.4) for induction initiation

  • Monitoring expression: For membrane proteins like ctaB, subcellular fractionation followed by immunodetection provides the most reliable assessment of expression levels and proper membrane integration

The fourfold increase in active protein observed when using optimized 5'-UTRs would be particularly valuable for membrane proteins, which often express at lower levels than soluble proteins .

How can homologous recombination techniques be optimized for targeted integration of the ctaB gene into the S. acidocaldarius genome?

Homologous recombination in S. acidocaldarius can be optimized through several methodological approaches:

  • Vector design for targeted integration:

    • Include ~500 bp homologous regions flanking the target integration site

    • Employ a two-step pop-in/pop-out strategy using pyrE as a counter-selectable marker

    • Consider the proximity of mutations in the design, as ME-promoted recombination remains effective even with mutations separated by only a few base pairs

  • Transformation optimization:

    • Pre-treatment of cells in early-logarithmic phase improves efficiency

    • Post-electroporation recovery at 75°C in rich media enhances recombination rates

    • Direct plating on selective media after appropriate recovery period

  • Selection strategies:

    • Blue/white screening for initial selection

    • Secondary selection using 5-FOA for pyrE-based counter-selection

    • PCR screening to confirm proper integration

Notably, S. acidocaldarius demonstrates efficient recombination even with shorter homologous regions compared to bacterial systems, with detectable recombination occurring between mutations separated by as little as 10 bp .

How does the UVB-induced DNA repair mechanism in S. acidocaldarius affect recombinant protein stability and expression?

UV-induced DNA damage triggers a complex cellular response in S. acidocaldarius that impacts recombinant protein expression:

Understanding this natural DNA transfer and repair system provides opportunities for developing novel genetic manipulation techniques in S. acidocaldarius .

What methodologies are most effective for characterizing the enzymatic activity of recombinant Protoheme IX farnesyltransferase from S. acidocaldarius?

Characterizing ctaB activity requires specialized approaches due to its membrane localization and thermophilic nature:

  • Membrane fraction preparation:

    • Cell disruption via sonication in high-salt buffer (20 mM Tris-HCl pH 8.0, 300 mM NaCl)

    • Differential centrifugation: low-speed (10,000 × g, 20 min) followed by high-speed (100,000 × g, 1 hour)

    • Membrane resuspension in buffer containing 0.5% suitable detergent (DDM or Triton X-100)

  • Activity assay methods:

    • Spectrophotometric assay: Monitoring conversion of heme B to heme O through absorbance changes at specific wavelengths (typically 410 nm)

    • HPLC analysis: Separation and quantification of heme B and heme O

    • Mass spectrometry: Precise identification of heme conversion products and intermediates

  • Controls and validation:

    • Comparison with recombinant ctaB from mesophilic organisms as activity control

    • Site-directed mutagenesis of conserved residues to confirm catalytic mechanism

    • Temperature dependence studies (25-85°C) to confirm thermostability

When studying membrane proteins like ctaB, assessment of proper membrane integration is critical before activity measurements, as misfolded protein can result in false negative results for enzymatic activity .

How can the alba 5'-UTR be optimized for maximum expression of ctaB in S. acidocaldarius?

Optimization of the alba 5'-UTR requires systematic experimental design:

  • Shine-Dalgarno (SD) motif optimization:

    • Site-directed mutagenesis of the SD sequence demonstrates its critical importance

    • Optimal distance between SD and start codon appears to be 8-12 nucleotides

    • Preservation of the "AA" nucleotides at positions -2 and -1 upstream of start codon provides optimal expression

  • 5'-UTR length considerations:

    • The full-length alba 5'-UTR (saci_1322) provides approximately 4-fold increase in protein yields

    • Truncation experiments can determine the minimal functional length

    • The intact SD motif must be preserved for functionality

  • Combination with alternative promoters:

    PromoterCharacteristicsCompatibility with alba 5'-UTR
    P<sub>ara</sub> (saci_2122)Arabinose-inducible, low basal activityHighly compatible, 4-fold yield increase
    P<sub>constitutive</sub>Continuous expressionCompatible but may cause metabolic burden
    P<sub>heat shock</sub>Temperature-inducedRequires further investigation
  • Experimental validation protocol:

    • Construction of expression vectors with variant 5'-UTRs

    • Transformation into S. acidocaldarius

    • Measurement of target protein via activity assays, SDS-PAGE, and immunodetection

    • Normalization to total cell protein for comparison

For membrane proteins like ctaB, the combination of alba 5'-UTR with proper membrane targeting signals is particularly important for successful expression and proper localization .

What are the critical parameters for successful transformation of S. acidocaldarius with recombinant ctaB constructs?

Successful transformation requires careful optimization of multiple parameters:

  • Cell preparation:

    • Harvest cells in early- to mid-logarithmic phase (OD<sub>600</sub> 0.2-0.4)

    • Wash cells thoroughly in 20 mM sucrose to remove media components

    • Maintain cells at 4°C throughout preparation to maximize competence

  • DNA preparation considerations:

    • Methylation status: Unmethylated DNA often yields higher transformation efficiency

    • DNA concentration: Optimal range 100-500 ng of plasmid DNA

    • DNA purity: A260/A280 ratio >1.8 for optimal results

  • Electroporation parameters:

    • Pulse settings: 1.5 kV, 25 μF, 600 Ω in 1 mm cuvettes

    • Cell density: 1×10<sup>9</sup> to 1×10<sup>10</sup> cells/mL

    • Volume: 50-100 μL total volume including DNA

  • Post-electroporation recovery:

    • Immediate transfer to pre-warmed recovery medium

    • Recovery at 75°C for 30-60 minutes enhances transformation efficiency

    • Direct plating on selective media appropriate for the selection marker used

When working with recombinant constructs containing membrane proteins like ctaB, special attention should be paid to the potential toxicity during expression, which may necessitate adjustments to the recovery and selection protocols .

How can site-directed mutagenesis be performed effectively to study critical residues in the ctaB gene of S. acidocaldarius?

Site-directed mutagenesis in S. acidocaldarius can be accomplished through several approaches:

  • Oligonucleotide-directed mutagenesis:

    • Design synthetic oligonucleotides (35-45 bp) carrying desired mutations

    • Introduce via electroporation into appropriate recipient strains

    • Selection of recombinants by direct plating on selective media

    • Even with short oligonucleotides, reasonable numbers of recombinants can be obtained

  • PCR-based techniques:

    • Overlap extension PCR using mutagenic primers

    • Assembly of ~500 bp flanking regions with the mutated gene

    • Transformation and selection based on pyrE or other markers

  • Specific considerations for ctaB mutations:

    • Mutations affecting conserved catalytic residues may be lethal if ctaB is essential

    • Design complementation strategies to maintain viability

    • Consider using inducible promoters to control expression of mutant variants

  • Verification methods:

    • Sequencing of the targeted region to confirm the desired mutation

    • Phenotypic characterization to assess functional impact

    • Western blotting to verify protein expression levels

For residues involved in substrate binding or catalysis, conservative substitutions should be considered first to avoid complete loss of function if ctaB is essential for S. acidocaldarius viability .

How should researchers interpret expression data for recombinant ctaB in S. acidocaldarius compared to other hosts?

Proper analysis of expression data requires consideration of multiple factors:

When interpreting expression data for membrane proteins like ctaB, successful membrane integration is a critical metric beyond simple expression levels and should be explicitly assessed .

What structural and functional analyses can reveal the thermostability mechanisms of S. acidocaldarius ctaB?

Understanding the thermostability of ctaB requires multiple analytical approaches:

  • Computational structural analysis:

    • Homology modeling based on known protoheme IX farnesyltransferase structures

    • Molecular dynamics simulations at elevated temperatures (75-85°C)

    • Identification of potential stabilizing features: ion pairs, hydrophobic cores, disulfide bonds

  • Experimental structural characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure stability at different temperatures

    • Differential scanning calorimetry (DSC) to determine melting temperature (T<sub>m</sub>)

    • Limited proteolysis to identify stable domains and flexible regions

  • Comparative analysis approaches:

    • Sequence alignment with mesophilic homologs to identify unique features

    • Site-directed mutagenesis of potential thermostabilizing residues

    • Creation of chimeric proteins with mesophilic counterparts to localize thermostability determinants

  • Functional thermostability assessment:

    • Activity measurements across temperature range (30-95°C)

    • Long-term stability studies at elevated temperatures

    • pH-temperature activity profiles to determine optimal conditions

The results can guide protein engineering efforts for applications requiring thermostable enzymes and provide fundamental insights into protein adaptation to extreme environments .

What are the potential biotechnological applications of recombinant thermostable ctaB from S. acidocaldarius?

Thermostable ctaB offers several potential biotechnological applications:

  • Biocatalysis applications:

    • Modification of heme-containing compounds under extreme conditions

    • Production of modified hemes for specialized applications

    • Integration into multi-enzyme cascades requiring high-temperature stability

  • Analytical tools:

    • Development of thermostable biosensors for heme detection

    • High-temperature compatible diagnostic reagents

    • Stable standards for analytical techniques

  • Expression system contributions:

    • The optimization strategies developed for ctaB expression can improve general S. acidocaldarius expression systems

    • Use as a model for expression of other challenging membrane proteins

    • Development of fusion partners to enhance stability of other proteins

  • Industrial relevance:

    • Understanding respiratory chains in extremophiles has implications for bioremediation

    • Potential applications in specialized fermentation processes

    • Contributions to sustainable bioprocessing at elevated temperatures

The advancements in recombinant expression techniques for S. acidocaldarius, particularly the integration of SD-motif containing 5'-UTRs, significantly broadens the utility of this archaeal expression platform for these potential applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.