Recombinant Sulfolobus islandicus Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Sulfolobus islandicus CobS

Recombinant Sulfolobus islandicus cobalamin synthase (CobS) is a thermostable enzyme involved in the final steps of cobalamin (vitamin B₁₂) biosynthesis. This protein is heterologously expressed in Escherichia coli and purified for biochemical and industrial applications . The UniProt ID for CobS is C3N0R7, and it is annotated as a cobalamin synthase (EC 2.-.-.-) .

Key Properties

PropertyDetails
Source OrganismSulfolobus islandicus (strain M.16.27)
Expression HostEscherichia coli
Protein LengthPartial (specific residues not fully disclosed)
Purity>85% (verified by SDS-PAGE)
Storage Conditions-20°C/-80°C (lyophilized form; 12-month shelf life)
ReconstitutionSterile deionized water with 5–50% glycerol (recommended)

Enzymatic Function and Role in Cobalamin Biosynthesis

CobS catalyzes the adenosylation of cobalamin precursors, a critical step in the anaerobic cobalamin biosynthesis pathway . In Salmonella enterica, CobS localizes to the cell membrane and mediates the transfer of an adenosyl group to the cobalt ion in the corrin ring . This activity is conserved in archaea, as demonstrated by functional complementation studies using the Methanobacterium thermoautotrophicum CobS homolog .

Key Steps in CobS Activity

  1. Cobalt Insertion: Precorrin-2 undergoes cobalt chelation by CobNST (class I chelatase) .

  2. Reduction: CobR reduces Co(II) to Co(I) .

  3. Adenosylation: CobS transfers the adenosyl group to Co(I)-precorrin-2, forming adenosylcobalamin .

Production and Purification

Recombinant CobS is produced using the Sulfolobus-E. coli shuttle vector system. Key steps include:

  • Cloning: The cobS gene (partial) is inserted into a plasmid under an arabinose-inducible promoter .

  • Expression: High-yield expression is achieved in S. islandicus or E. coli at 76°C (optimal for thermostability) .

  • Purification: Affinity chromatography (e.g., His-tag) followed by lyophilization .

Critical Notes

  • Repeated freeze-thaw cycles degrade activity; aliquots stored at 4°C retain functionality for ≤1 week .

  • Glycerol (50% final concentration) enhances long-term stability .

Applications and Research Utility

  • Industrial Biotechnology: Used in enzymatic synthesis of cobalamin derivatives for pharmaceuticals .

  • Metabolic Engineering: Integration into S. islandicus chassis for optimizing vitamin B₁₂ production .

  • Structural Studies: Serves as a model for archaeal metalloenzyme mechanisms .

Challenges and Future Directions

  • Partial Protein Limitation: The recombinant CobS available commercially is a truncated form; full-length protein studies are needed .

  • Heterologous Compatibility: Improving expression yields in mesophilic hosts (e.g., E. coli) remains a hurdle .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; M1425_2132; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
Target Names
cobS
Target Protein Sequence
MRLKGVLALFSFFTAIPIKSNASLEEIAEYSYISPLIIGISLALIESAVYVLLYRILEAL AGIVLLGVVELLRGFNHLDGLLDLGDALMIKGDRERKIKALKDVEIGSGGIGLLLVYLSI QIVALLKLGFSFYTIFYLISSNVLSMTIGLYILSTISPIPESNLGKIFHNKLKGKSTVLL FELIPFISLYNIIVFLVFYMIMHKICRSLGGSSGDIAGASITLSFPLFLLTNEITNLNYS LLSILCYLFLYLH
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sulfolobus islandicus and why is it significant for studying cobS?

Sulfolobus islandicus is a model microorganism belonging to the TACK superphylum of Archaea, representing a key lineage in the evolutionary history of cells . As a thermophilic archaeon, it offers unique insights into extremophile adaptations and archaeal biology. S. islandicus has emerged as an important genetic model for archaeal research due to the development of sophisticated genetic manipulation tools, including CRISPR-Cas based systems . Genome-wide studies of S. islandicus have revealed surprising findings about gene essentiality, including the unexpected discovery that the proteinaceous S-layer, previously assumed essential for archaeal cells, is actually non-essential . This organism provides an excellent platform for studying specialized proteins such as Cobalamin synthase (cobS) in the context of thermophilic adaptation.

What is Cobalamin synthase (cobS) and what function does it serve?

Cobalamin synthase (cobS), also known as Adenosylcobinamide-GDP ribazoletransferase or Cobalamin-5'-phosphate synthase, is an enzyme involved in the biosynthesis pathway of vitamin B12 (cobalamin) . In S. islandicus, cobS catalyzes critical steps in the assembly of the complete cobalamin molecule. Specifically, it facilitates the attachment of components to the corrin ring structure, a crucial process in producing functional vitamin B12. The enzyme is identified in the S. islandicus genome with the designation YG5714_2259 . Understanding cobS function provides insights into both the evolution of essential vitamin biosynthesis pathways and archaeal metabolic adaptations to extreme environments.

What expression systems are effective for producing recombinant S. islandicus cobS?

ParameterOptimization StrategyRationale
Expression temperatureLower induction temperature (15-25°C)Reduces inclusion body formation
Induction conditionsReduced IPTG concentration (0.1-0.5 mM)Slower expression can improve folding
Fusion tagsN-terminal His-tag as demonstratedFacilitates purification while minimizing interference
Host strainE. coli strains with additional tRNAsAccommodates codon usage differences

For studies requiring native-like post-translational modifications or investigation of temperature-dependent characteristics, homologous expression in S. islandicus itself may be preferable, using the genetic tools that have been developed for this organism, such as the CRISPR-Cas based genome editing systems described in the literature .

What are the optimal conditions for purifying active recombinant S. islandicus cobS?

Purification of active recombinant S. islandicus cobS requires consideration of its thermophilic nature and potential membrane association. Based on available protocol information, the following guidelines should be considered :

  • Buffer composition: Tris/PBS-based buffer at pH 8.0 has been successfully used, supplemented with 6% trehalose as a stabilizing agent.

  • Storage conditions: The purified protein should be stored at -20°C/-80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles.

  • Reconstitution approach: After lyophilization, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (optimally 50%) for long-term storage.

  • Thermostability advantage: Given the thermophilic origin of S. islandicus cobS, a heat treatment step (65-70°C) during purification can be employed to selectively denature contaminant E. coli proteins while leaving the thermostable cobS protein in solution.

How can CRISPR-Cas systems be utilized to study cobS function in S. islandicus?

CRISPR-Cas systems have been successfully adapted for genome editing in S. islandicus, offering powerful tools to study cobS function . A genome-editing plasmid (pGE) carrying an artificial mini-CRISPR array can be designed to target the cobS gene. This approach creates two alternative outcomes for transformed cells: wild-type cells are targeted for chromosomal DNA degradation (leading to cell death), while cells that incorporate the desired mutation through homologous recombination with a provided donor DNA survive .

This strategy can be used to:

  • Generate clean deletions: Remove the cobS gene to study the impact on cell viability and metabolism.

  • Create point mutations: Introduce specific amino acid changes to study structure-function relationships.

  • Insert tags: Add epitope or fluorescent tags for localization and interaction studies.

The key advantage of this approach is that it allows for markerless modifications of the S. islandicus genome, facilitating the study of cobS in its native context . Understanding the PAM (protospacer adjacent motif) requirements is essential - for S. islandicus, the Type I-A CRISPR-Cas system recognizes CCN and TCN PAM sequences at the 5'-flanking position of the protospacer .

What methodological approaches are most effective for characterizing cobS enzymatic activity?

Characterizing the enzymatic activity of thermophilic S. islandicus cobS requires specialized approaches that account for its high-temperature optimum. Effective methodological approaches include:

  • Spectrophotometric assays: Monitoring changes in absorbance during the reaction, particularly in the range where corrin ring structures absorb (350-550 nm).

  • HPLC analysis: Separating and quantifying substrates and products of the cobS reaction using reverse-phase chromatography.

  • Assay temperature considerations: All assays should be performed at temperatures approximating the native growth temperature of S. islandicus (70-80°C) using thermostable buffer systems.

  • Stability assessment: Thermal shift assays can be used to determine if the recombinant protein maintains the expected thermostability profile, which is a good indicator of proper folding.

When developing activity assays, researchers should consider that the optimal temperature for enzyme activity will likely be significantly higher than typical laboratory assays for mesophilic proteins.

What genetic approaches can determine if cobS is essential in S. islandicus?

Determining gene essentiality in S. islandicus has been accomplished through several complementary approaches that could be applied to study cobS :

  • Transposon mutagenesis: Genome-wide transposon insertion libraries can be generated and analyzed to identify genes that cannot tolerate disruption. If cobS is essential, transposon insertions in this gene would be absent or significantly underrepresented in the viable population .

  • Targeted gene deletion attempts: Using CRISPR-Cas genome editing or conventional marker insertion and unmarked target gene deletion (MID) methods to attempt deletion of cobS . Failed attempts to obtain viable deletion mutants suggest essentiality.

  • Conditional expression systems: Creating strains where cobS expression is placed under the control of an inducible promoter allows for controlled depletion experiments. Growth cessation upon depletion would indicate essentiality.

  • Complementation testing: Providing a functional copy of cobS on a plasmid prior to attempting chromosomal deletion can confirm that lethality is specifically due to the absence of cobS function rather than polar effects.

These approaches have been successfully applied to other genes in S. islandicus, such as the S-layer genes, which were previously assumed essential but were proven non-essential through targeted deletion studies .

What are common challenges when working with recombinant S. islandicus proteins and how can they be addressed?

Working with recombinant proteins from thermophilic archaea presents several technical challenges:

ChallengeManifestationSolution
Protein misfoldingPoor solubility, inclusion body formationLower expression temperature; add stabilizing agents like trehalose
Loss of activityDecreased enzymatic function after purificationInclude glycerol in storage buffers; minimize freeze-thaw cycles
Buffer incompatibilityProtein precipitation or aggregationTest thermostable buffers at different pH values; Tris/PBS at pH 8.0 has proven effective
Expression yieldLow protein productionOptimize codon usage; test different E. coli strains; consider using S. islandicus expression systems
Improper temperature for assaysSuboptimal activity measurementsConduct assays at temperatures approaching native conditions (70-80°C)

For downstream applications, researchers should consider the reconstitution recommendation of adding 5-50% glycerol to prevent freeze-thaw damage, with 50% being the default concentration used in published protocols .

How can researchers verify the structural integrity of purified recombinant S. islandicus cobS?

Verifying the structural integrity of purified recombinant S. islandicus cobS involves multiple analytical approaches:

  • SDS-PAGE analysis: Confirming protein purity (>90% as indicated in published protocols) and expected molecular weight .

  • Thermal stability assessment: Using differential scanning fluorimetry or circular dichroism with temperature ramping to verify the high melting temperature expected of a thermophilic protein.

  • Secondary structure analysis: Circular dichroism spectroscopy to confirm expected secondary structure content.

  • Activity assays: Ultimately, functional enzymatic assays provide the most direct confirmation of structural integrity.

  • Mass spectrometry: Confirming the intact mass and potential post-translational modifications.

The lyophilized form of the protein should produce a white powder that readily dissolves in the recommended reconstitution buffer to yield a homogeneous solution .

How does studying S. islandicus cobS contribute to understanding archaeal evolution?

Studying S. islandicus cobS provides valuable insights into archaeal evolution through several perspectives:

  • Phyletic distribution analysis: Comparing cobS occurrence across archaeal lineages helps identify genes that may have been associated with key evolutionary transitions . The TACK superphylum to which S. islandicus belongs represents a key lineage in cellular evolution, particularly in relation to eukaryotic origins.

  • Essential gene repertoire: Understanding whether cobS is part of the essential gene complement in S. islandicus provides insight into the core metabolic requirements of thermophilic archaea .

  • Comparative genomics: Analyzing the genomic context of cobS across archaea can reveal conservation patterns and potential co-evolution with other genes.

  • Adaptation signatures: Identifying amino acid composition biases or structural adaptations in cobS that correlate with thermophily can highlight molecular mechanisms of adaptation to extreme environments.

These evolutionary insights can inform broader questions about the development of fundamental cellular processes and metabolic pathways, particularly those shared between archaea and eukaryotes.

How does S. islandicus cobS compare to homologous proteins in bacteria and other archaea?

Comparative analysis of S. islandicus cobS with homologous proteins in bacteria and other archaea reveals important evolutionary and functional insights:

  • Sequence conservation: Core catalytic residues involved in cobalamin synthesis are likely conserved across domains, while thermostability-conferring residues may show adaptations specific to thermophilic lineages.

  • Domain architecture: Analysis of domain organization can reveal lineage-specific adaptations or domain acquisitions/losses.

  • Thermostability features: Comparison with mesophilic homologs can highlight specific substitutions or additional structural elements that contribute to the thermostability of S. islandicus cobS.

  • Substrate specificity: Variations in binding pocket residues may indicate adaptations for slightly different substrates or reaction conditions across different organisms.

Such comparative approaches place S. islandicus cobS in an evolutionary context that can reveal both the conserved core of this ancient metabolic pathway and the specific adaptations that allow it to function in extreme environments.

What are promising future research avenues involving S. islandicus cobS?

Several promising research directions could expand our understanding of S. islandicus cobS:

  • Structural characterization: Determining the three-dimensional structure of S. islandicus cobS would provide insights into thermostability mechanisms and substrate binding.

  • Metabolic engineering applications: Exploring the potential use of thermostable cobS in engineered pathways for vitamin B12 production at elevated temperatures.

  • Protein engineering: Using the thermostable framework of S. islandicus cobS as a scaffold for engineering novel enzymatic activities.

  • In vivo dynamics: Investigating the cellular localization, potential protein-protein interactions, and regulation of cobS activity in response to environmental changes.

  • Integration with systems biology: Placing cobS function in the context of global metabolic networks in S. islandicus through multi-omics approaches.

These research directions could not only advance our understanding of archaeal biochemistry but also potentially lead to biotechnological applications leveraging the thermostable properties of S. islandicus cobS.

How might studying S. islandicus cobS inform broader questions about extremophile adaptations?

Studying S. islandicus cobS can provide insights into general principles of protein adaptation to extreme environments:

  • Thermostability mechanisms: Identifying specific amino acid substitutions, additional salt bridges, or hydrophobic interactions that contribute to cobS thermostability.

  • Metabolic adaptations: Understanding how essential vitamin biosynthesis pathways are maintained under extreme conditions.

  • Evolutionary strategies: Revealing whether thermophilic adaptations in cobS arose through gradual selection or horizontal gene transfer events.

  • Functional flexibility: Determining whether extremophile enzymes like cobS maintain functional activity across a broader temperature range than mesophilic counterparts.

These insights can contribute to our broader understanding of life's adaptability to extreme environments and potentially inform astrobiology research about the limits of biochemical processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.