Recombinant Sulfolobus islandicus filamentous virus Putative transmembrane protein 10 (SIFV0010)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SIFV0010; Putative transmembrane protein 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) (SIFV)
Target Names
SIFV0010
Target Protein Sequence
MNNFSYFSTIFSIALMSSNAFAGNDTLLVGFCPCIEINTLTLFLSSLYAIKPSDSCSPSY TSNLLNLFCDFVNSSTHLSISVFSSSVLSCFTSCFVIYFYPFFVFDSASYCVFNSSSREG CTSVTIGWG
Uniprot No.

Target Background

Database Links

KEGG: vg:922316

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is Sulfolobus islandicus filamentous virus Putative transmembrane protein 10 (SIFV0010)?

SIFV0010 is a putative transmembrane protein derived from Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi). It is a full-length protein comprising 129 amino acids with a UniProt accession number of Q914M0. The protein is part of the viral structural components and is classified as a putative transmembrane protein, suggesting its likely role in viral envelope structure and potential host-cell interaction functions . Sulfolobus islandicus is a hyperthermophilic crenarchaeon, which means SIFV0010 has adapted to function under extreme temperature conditions, making it particularly interesting for researchers studying protein stability and hyperthermophilic systems .

What are the recommended storage conditions for recombinant SIFV0010?

For optimal stability and activity maintenance of recombinant SIFV0010, the following storage conditions are recommended:

Storage PurposeTemperatureDurationAdditional Information
Standard storage-20°CMedium-termIn Tris-based buffer with 50% glycerol
Extended storage-20°C to -80°CLong-termOptimized buffer conditions
Working aliquots4°CUp to one weekAvoid repeated freeze-thaw cycles

Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity. It is advisable to prepare small working aliquots to minimize freeze-thaw cycles . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein to maintain stability.

What are key experimental design principles when working with hyperthermophilic proteins like SIFV0010?

When designing experiments involving hyperthermophilic proteins such as SIFV0010, researchers should implement the following methodological approaches:

  • Temperature Control: Maintain consistent temperature conditions throughout the experiment, especially during activity assays. Given the hyperthermophilic nature of Sulfolobus islandicus (the source organism), temperature stability is crucial for obtaining reliable results .

  • Blocking Design: Implement blocking in your experimental design to group similar experimental units together, reducing variability within each block. This makes treatment effects easier to detect and allows for more precise estimates with fewer experimental units .

  • Minimize Variability: Reducing experimental variability is crucial for maximizing effectiveness with limited resources. This enhances the power of experiments to detect true effects, ensuring efficient utilization of time and resources .

  • Control for Confounding Variables: Address potential confounding variables through proper experimental controls, especially when studying protein-protein interactions or functional assays involving SIFV0010 .

  • Randomization: Implement randomization in experimental designs to distribute unknown sources of variation randomly across treatment groups, enhancing the validity of statistical analyses .

How can I optimize expression systems for recombinant SIFV0010?

Based on research with similar archaeal proteins, the optimization of expression systems for SIFV0010 should consider:

  • Vector Selection: The pSeSD and pEXA expression vectors have been successfully used for expressing proteins in Sulfolobus islandicus. These vectors contain multiple restriction sites and coding sequences for hexahistidine (6×His) tags, facilitating purification .

  • Promoter Selection: The araS promoter has demonstrated high-level expression capabilities in S. islandicus. The P₍ₐᵣₐₛ₋ₛₘ₎ derivative promoter with an engineered ribosome-binding site (Shine-Dalgarno sequence) can direct even higher levels of target gene expression .

  • Host Selection: S. islandicus E233S carrying ΔpyrEF and ΔlacS mutations has been successfully used as a hyperthermophilic archaeal host for producing recombinant proteins .

  • Temperature and Growth Conditions: Optimize growth conditions based on the hyperthermophilic nature of the host organism, typically at temperatures between 75-85°C for Sulfolobus species.

  • Induction Parameters: When using inducible promoters like the arabinose-inducible promoter, optimize inducer concentration and induction timing to maximize protein yield while maintaining proper folding.

What purification strategies are most effective for SIFV0010?

Effective purification of recombinant SIFV0010 can be achieved through the following methodological approach:

  • Affinity Chromatography: Utilize the hexahistidine (6×His) tag incorporated into the expression vectors to perform immobilized metal affinity chromatography (IMAC), typically using Ni-NTA or Co-NTA resins .

  • Heat Treatment: Exploit the thermostable nature of SIFV0010 by incorporating a heat treatment step (65-80°C) to denature less stable host proteins while retaining the activity of the thermostable target protein.

  • Size Exclusion Chromatography: Implement gel filtration as a polishing step to separate the protein of interest from aggregates and to ensure homogeneity of the final product.

  • Tag Removal: If necessary, remove the affinity tag using the engineered protease sites present in the expression vectors. This can be particularly important for structural or functional studies where the tag might interfere .

  • Buffer Optimization: During purification, maintain buffer conditions that stabilize the protein, potentially including glycerol and reducing agents to prevent aggregation and oxidation.

How can I validate the functionality of purified recombinant SIFV0010?

Validation of recombinant SIFV0010 functionality can be approached through multiple complementary methods:

  • ELISA-Based Assays: Develop and implement enzyme-linked immunosorbent assays using anti-SIFV0010 antibodies to confirm the protein's identity and structural integrity .

  • Immunofluorescence Assays: Adapt techniques similar to those used for other viral proteins, such as the recombinant nucleocapsid-based immunofluorescence assays, to assess SIFV0010's binding capabilities and localization .

  • Circular Dichroism (CD) Spectroscopy: Employ CD spectroscopy to analyze the secondary structure content of the purified protein and compare it with computational predictions based on the amino acid sequence.

  • Thermal Stability Assays: Given the hyperthermophilic origin of SIFV0010, perform thermal shift assays to confirm the protein's stability profile under various temperature conditions.

  • Membrane Association Studies: Use liposome binding assays or detergent partition experiments to validate the predicted transmembrane properties of SIFV0010.

How do I troubleshoot poor expression yields of SIFV0010?

When encountering low expression yields of SIFV0010, systematic troubleshooting should include:

  • Codon Optimization: Analyze the codon usage in the SIFV0010 gene and optimize it for the expression host, particularly if using heterologous expression systems.

  • Vector and Promoter Evaluation: Compare expression levels between different vectors and promoters. The araS promoter has shown high expression levels for proteins in S. islandicus systems .

  • Expression Conditions Screening: Systematically vary expression conditions including temperature, induction time, and inducer concentration in a factorial experimental design to identify optimal parameters .

  • Host Strain Selection: Test multiple host strains, particularly focusing on those designed for membrane protein expression if expressing the full-length transmembrane protein.

  • Fusion Protein Approach: Consider expressing SIFV0010 as a fusion with a soluble partner protein to potentially improve folding and solubility.

What approaches are recommended for structural studies of SIFV0010?

For structural characterization of SIFV0010, consider the following methodological approaches:

  • X-ray Crystallography: For crystallization trials, focus on:

    • Screening multiple constructs with varying N- and C-terminal boundaries

    • Using detergents suitable for membrane protein crystallization

    • Implementing in situ proteolysis to remove flexible regions

    • Exploring lipidic cubic phase crystallization for transmembrane domains

  • Cryo-Electron Microscopy: Consider single-particle cryo-EM for structural determination, particularly if the protein forms higher-order assemblies or if crystallization proves challenging.

  • NMR Spectroscopy: For analysis of specific domains or peptide fragments of SIFV0010, particularly those suspected to be involved in protein-protein interactions.

  • Computational Structure Prediction: Utilize advanced prediction tools like AlphaFold2 as a complementary approach, especially useful for generating working models and designing experimental constructs.

  • Hydrogen-Deuterium Exchange Mass Spectrometry: To probe the dynamics and solvent accessibility of different regions of the protein, providing insights into functional domains.

How can I investigate potential protein-protein interactions involving SIFV0010?

To systematically explore protein-protein interactions involving SIFV0010, implement the following comprehensive approach:

  • Co-Immunoprecipitation Assays: Design co-IP experiments using antibodies against SIFV0010 or potential interaction partners, adapting protocols for membrane proteins.

  • Split-Reporter Assays: Implement bacterial or yeast two-hybrid systems modified for membrane proteins to screen for potential interaction partners.

  • Cross-Linking Mass Spectrometry: Utilize chemical cross-linkers followed by mass spectrometry analysis to identify proteins in proximity to SIFV0010 in native or reconstituted systems.

  • Surface Plasmon Resonance (SPR): Develop SPR assays with immobilized SIFV0010 or candidate interaction partners to quantitatively measure binding affinities and kinetics.

  • Fluorescence Resonance Energy Transfer (FRET): Design FRET-based assays to monitor potential interactions in real-time, particularly useful for dynamic or transient interactions.

How do transmembrane proteins from archaeal viruses differ from those of bacteria and eukaryotes?

Archaeal viral transmembrane proteins like SIFV0010 exhibit several distinctive characteristics compared to their bacterial and eukaryotic counterparts:

FeatureArchaeal Viral TMPsBacterial Viral TMPsEukaryotic Viral TMPs
Membrane compositionAdapted to archaeal lipids (ether-linked, branched)Adapted to bacterial lipids (ester-linked)Adapted to eukaryotic lipids (sterols, sphingolipids)
Thermal stabilityOften extremely thermostable (e.g., SIFV0010)Variable stabilityTypically mesophilic
Structural motifsUnique adaptations to extreme conditionsCommon transmembrane motifsComplex glycosylation and processing
EvolutionDistinct archaeal lineageBacterial phage lineageEukaryotic viral lineage
Host interactionMechanisms adapted to archaeal cell surfacesBacterial cell wall interactionComplex receptor interactions

Understanding these differences is crucial for designing experimental approaches that account for the unique properties of archaeal systems, particularly when expressing these proteins in heterologous hosts or analyzing their functions .

What are emerging research directions for archaeal viral transmembrane proteins like SIFV0010?

Future research with SIFV0010 and related archaeal viral transmembrane proteins may focus on:

  • Biotechnological Applications: Exploring the potential use of thermostable viral proteins in biotechnology, particularly as scaffolds for protein engineering or as components in high-temperature bioprocesses.

  • Evolutionary Studies: Investigating the evolutionary relationships between archaeal viral proteins and their hosts to understand viral adaptation mechanisms to extreme environments.

  • Structural Biology Advancements: Developing improved methods for structural studies of archaeal membrane proteins, potentially leading to novel insights into protein stability under extreme conditions.

  • Host-Virus Interaction Mechanisms: Elucidating the specific mechanisms by which archaeal viruses like SIFV interact with their hyperthermophilic hosts through proteins like SIFV0010.

  • Comparative Systems Biology: Implementing systematic comparative analyses between archaeal, bacterial, and eukaryotic viral systems to identify conserved and divergent features in viral life cycles and host interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.