Recombinant Sulfolobus islandicus filamentous virus Putative transmembrane protein 49 (SIFV0049)

What is SIFV0049 and what is its biological context?

SIFV0049 is a putative transmembrane protein encoded by the Sulfolobus islandicus filamentous virus (SIFV), an archaeal virus belonging to the Lipothrixviridae family, specifically the Betalipothrixvirus genus . The protein consists of 140 amino acids and has a UniProt accession number of Q914I3 . SIFV infects the hyperthermophilic and acidophilic archaeon Saccharolobus islandicus LAL14/1 (formerly known as Sulfolobus islandicus), which thrives in extreme environments with high temperatures and low pH . The virus itself is characterized by its enveloped, flexible, filamentous structure measuring approximately 2 μm in length and 24 nm in width, decorated with terminal mop-like structures at each end that likely play a role in host recognition . Unlike most enveloped viruses, SIFV virions are assembled and enveloped within the host cell cytoplasm rather than through budding, presenting a unique mechanism of virion morphogenesis .

What is the amino acid sequence and predicted structural features of SIFV0049?

The complete amino acid sequence of SIFV0049 is: MVRALLFHVITYTKFIVPVVKLLIMSAIAGVIAGAFGGGIGGVGDAIGTIIGDLERAIARFGGSIVNAFKTVIDKILTLAVRIGRIIEKYFRIAVHYIVLFLRLAYRYMYSFYTEFQKDPWRSLQFVGSMAILLNNSLFP . Structural analysis predicts that SIFV0049 is a transmembrane protein, suggesting it contains hydrophobic domains capable of spanning lipid bilayers . The protein likely adopts a mainly alpha-helical conformation in the transmembrane regions, with the hydrophobic residues oriented toward the lipid environment and hydrophilic residues facing the aqueous phase or protein interior. The N-terminal region (approximately residues 1-20) appears to contain a signal sequence typical of membrane proteins, while the central region (approximately residues 20-100) likely contains the transmembrane domains. The C-terminal region may be involved in protein-protein interactions or other functional activities. Detailed structural characterization through X-ray crystallography or cryo-electron microscopy would be necessary to confirm these predictions.

How can recombinant SIFV0049 be expressed and purified for research purposes?

For recombinant expression of SIFV0049, Escherichia coli is a common host system, particularly for initial characterization studies . The SIFV0049 gene can be PCR-amplified from viral genomic DNA, cloned into an expression vector (such as pET series vectors), and transformed into an E. coli expression strain like BL21(DE3) . Expression conditions typically require optimization, with induction using IPTG at concentrations between 0.1-1.0 mM when culture density reaches OD600 of 0.6-0.8. Expression at lower temperatures (16-25°C) often enhances proper folding of membrane proteins. For purification, a His-tag is commonly incorporated, allowing for nickel affinity chromatography . Cell lysis is performed using detergents (such as n-dodecyl-β-D-maltoside or Triton X-100) to solubilize membrane proteins, followed by centrifugation to remove insoluble material. The purification typically involves immobilized metal affinity chromatography (IMAC), followed by size exclusion chromatography to improve purity. Alternative expression systems like insect cells or mammalian cells might provide better folding environments for functional studies, though with increased complexity and cost compared to bacterial systems.

What are the suitable storage conditions for recombinant SIFV0049?

Optimal storage of recombinant SIFV0049 requires careful consideration of buffer composition and temperature to maintain protein stability and functionality . According to product specifications, purified SIFV0049 should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage, while long-term storage is recommended at -80°C . The high glycerol concentration prevents freezing damage by acting as a cryoprotectant. The storage buffer should be optimized specifically for SIFV0049 stability, potentially including stabilizing agents such as reducing agents (DTT or β-mercaptoethanol at 1-5 mM) to prevent oxidation of cysteine residues. For working aliquots, storage at 4°C is recommended for up to one week to minimize freeze-thaw cycles which can lead to protein denaturation and aggregation . When handling the protein, it's advisable to keep it on ice and add protease inhibitors to prevent degradation. Stability tests comparing different buffer conditions (varying pH, salt concentration, and additives) should be performed to determine the optimal storage formulation for specific experimental applications.

How does SIFV0049 potentially contribute to viral assembly and host interaction?

Based on comparative analysis with related archaeal viruses, SIFV0049 likely plays a crucial role in the unique virion assembly process that occurs within the host cytoplasm . Unlike most enveloped viruses that acquire their envelope through budding, SIFV virions are fully assembled and enveloped inside the host cell, suggesting that transmembrane proteins like SIFV0049 may facilitate the recruitment and organization of lipid components for envelope formation . The protein may also contribute to the arrangement of virions into twisted bundles organized on a nonperfect hexagonal lattice as observed in electron tomography studies . For host interaction, the hydrophobic domains in SIFV0049 might enable insertion into host membranes, potentially creating pores or modifying membrane permeability to facilitate viral release or resource acquisition. To investigate these potential functions, researchers could employ techniques such as co-immunoprecipitation with viral and host proteins, localization studies using fluorescently tagged SIFV0049, and mutagenesis of key domains followed by functional assays. Additionally, studying the temporal expression pattern of SIFV0049 during the viral infection cycle could provide insights into its role in different stages of viral replication and assembly.

What approaches can be used to investigate the membrane topology and orientation of SIFV0049?

Investigating the membrane topology of SIFV0049 requires a multi-technique approach to determine which segments span the membrane and the orientation of the N- and C-termini . Protease protection assays provide a straightforward method where membrane vesicles containing the protein are treated with proteases; regions exposed to the external environment are digested while membrane-embedded or internal regions remain protected. Mass spectrometry analysis of the protected fragments reveals which regions are membrane-spanning. Cysteine scanning mutagenesis combined with chemical labeling is another powerful approach, where single cysteine residues are introduced at various positions along the protein sequence, and their accessibility to membrane-impermeable sulfhydryl reagents indicates whether they face the aqueous or lipid environment. Fluorescence resonance energy transfer (FRET) measurements between labeled domains can provide distance information, helping to map the three-dimensional arrangement of the protein within the membrane. For higher resolution structural information, techniques such as cryo-electron microscopy of SIFV0049 reconstituted into nanodiscs or electron paramagnetic resonance (EPR) spectroscopy with spin-labeled residues would be valuable. Additionally, computational prediction tools like TMHMM, MEMSAT, and Phobius can provide initial hypotheses about transmembrane regions to guide experimental design.

How can researchers investigate the role of SIFV0049 in the viral life cycle using genetic approaches?

Investigating SIFV0049's role in the viral life cycle requires developing and applying genetic manipulation systems for archaeal viruses, which presents significant challenges due to the extreme environments they inhabit . A promising approach involves generating SIFV0049 deletion or site-directed mutants using CRISPR-Cas systems adapted for hyperthermophilic conditions. Researchers would first need to establish a reverse genetics system for SIFV, which could involve: 1) Creating a replication-competent cDNA clone of the entire SIFV genome, 2) Introducing specific mutations in the SIFV0049 gene, and 3) Generating infectious viral particles from the mutated genome. Phenotypic characterization would then involve analyzing the effects on viral replication kinetics, virion morphology using electron microscopy, and viral assembly using dual-axis electron tomography. Complementation studies, where wild-type SIFV0049 is provided in trans, could confirm the specificity of observed phenotypes. Additionally, temperature-sensitive mutants could be particularly valuable for studying essential functions, allowing conditional inactivation. For studying protein-protein interactions, bacterial or yeast two-hybrid systems modified for hyperthermophilic proteins could be employed, potentially identifying host and viral factors that interact with SIFV0049. Successful implementation of these approaches would require careful optimization for the high-temperature, acidic conditions in which SIFV naturally replicates.

What methodologies can be applied to study SIFV0049 interaction with host cell components?

Studying SIFV0049 interactions with host components requires specialized approaches due to the extreme conditions in which Saccharolobus islandicus grows and the unique properties of archaeal membranes . Cross-linking mass spectrometry (XL-MS) offers a powerful method to capture transient interactions by chemically linking interacting proteins before analysis. The experiment should be performed under conditions mimicking the natural environment (pH 2-3, temperature 80-85°C) to capture biologically relevant interactions. Proximity-dependent biotin labeling methods like BioID or APEX2, adapted for thermostable enzymes, could identify proteins in the vicinity of SIFV0049 within living host cells. For direct binding studies, surface plasmon resonance (SPR) or microscale thermophoresis (MST) with thermostable protein preparations would provide quantitative interaction data. Fluorescence microscopy approaches using hyperthermophile-adapted fluorescent proteins fused to SIFV0049 could track its localization during infection, though this requires development of imaging systems capable of operating at high temperatures. Lipidomic analysis comparing the lipid composition of viral envelopes with host membranes would reveal whether SIFV0049 participates in selective lipid recruitment, especially important given that SIFV's envelope composition (enriched in C20-C25 caldarchaeol) differs significantly from the host membrane (primarily GDGT-4) . Finally, cryo-electron tomography of infected cells at different infection stages could visualize SIFV0049's distribution and potential reorganization of host structures.

How does SIFV0049 compare structurally and functionally to transmembrane proteins from other archaeal viruses?

Comparative analysis of SIFV0049 with transmembrane proteins from other archaeal viruses reveals both common features and distinct characteristics that reflect diverse viral adaptation strategies . Unlike the structurally characterized AFV1-102, AFV1-99, and SIFV-014 proteins, which are thought to be minor structural components involved in protein-protein interactions, SIFV0049 appears to have a primarily membrane-associated function . The protein lacks significant sequence homology with other characterized archaeal viral proteins, suggesting it may perform a specialized function specific to SIFV biology. While many archaeal viral transmembrane proteins are involved in host recognition or entry, SIFV0049's location within the virion structure suggests it may play a role in organizing the viral envelope, which is uniquely formed within the cytoplasm rather than through budding . Structural prediction indicates SIFV0049 likely contains multiple membrane-spanning domains, distinguishing it from single-pass transmembrane proteins found in some other archaeal viruses. Functionally, while proteins like gp43 from SIFV are known to form virus-associated pyramids (VAPs) for virion release, SIFV0049 may be involved in earlier stages of the viral life cycle, potentially in nucleocapsid envelopment or virion organization into bundles . These distinct features highlight the diversity of solutions evolved by archaeal viruses to address challenges posed by extreme environments.

What challenges are associated with studying the structure-function relationship of SIFV0049?

Studying the structure-function relationship of SIFV0049 presents several significant challenges inherent to working with proteins from hyperthermophilic archaeal viruses . First, obtaining sufficient quantities of properly folded recombinant protein requires overcoming expression obstacles, as heterologous expression systems like E. coli often cannot replicate the extreme conditions (80-85°C, pH 2-3) required for native folding of proteins from acidophilic hyperthermophiles. Transmembrane proteins like SIFV0049 present additional difficulties due to their hydrophobicity, toxicity to expression hosts, and tendency to form inclusion bodies . Structural determination is complicated by the protein's membrane-embedded nature, requiring specialized approaches such as detergent screening, lipid nanodisc reconstitution, or crystallization in lipidic cubic phases. Even after successful purification, maintaining the protein's stability during experimental procedures is challenging, as traditional structural biology techniques may not be optimized for hyperthermophilic proteins. Functional studies face the obstacle of recreating the virus's natural environment, including the extreme temperature and pH, as well as the unique archaeal membrane composition rich in tetraether lipids forming monolayers rather than bilayers . Finally, the limited availability of genetic tools for manipulating archaeal viruses restricts the ability to perform in vivo functional studies, requiring creative approaches to connect structural observations with biological roles.

How can researchers address the challenges of protein aggregation when working with recombinant SIFV0049?

Addressing protein aggregation when working with recombinant SIFV0049 requires a comprehensive strategy targeting multiple stages of protein production and handling . During expression, fusion tags such as SUMO or MBP can significantly enhance solubility by promoting proper folding and preventing aggregation. Lower induction temperatures (16-20°C) and reduced inducer concentrations often minimize inclusion body formation by slowing protein synthesis and allowing more time for proper folding. For cell lysis and extraction, specialized detergents like lauryl maltose neopentyl glycol (LMNG) or glyco-diosgenin (GDN) designed for membrane proteins can effectively solubilize SIFV0049 while maintaining its native conformation. The buffer composition requires careful optimization, potentially including stabilizing agents such as glycerol (20-30%), specific lipids that mimic the archaeal membrane environment, and chaotropic agents at low concentrations to prevent non-specific hydrophobic interactions. Size exclusion chromatography immediately following affinity purification helps remove aggregation-prone species before they can nucleate larger aggregates. For long-term storage and experimental use, researchers should employ dynamic light scattering (DLS) to monitor aggregation states before experiments and implement a centrifugation step (100,000 × g for 20 minutes) to remove any preformed aggregates. Finally, working at elevated temperatures (40-60°C) may actually improve the protein's stability and solubility, as SIFV0049 is naturally adapted to function at high temperatures in its native host environment.

What experimental design considerations are crucial for studying SIFV0049 interaction with archaeal-specific lipid membranes?

Designing experiments to study SIFV0049 interactions with archaeal lipid membranes requires careful consideration of the unique composition and properties of these membranes . Archaeal membranes, particularly in hyperthermophiles like Saccharolobus islandicus, consist primarily of glycerol dibiphytanyl glycerol tetraether (GDGT) lipids forming monolayers rather than the bilayers found in bacteria and eukaryotes . When preparing model membrane systems, researchers should use synthetic archaeal lipid analogs or lipid extracts from related archaea grown under similar conditions. Liposome preparation protocols need modification for tetraether lipids, including increased sonication time and potentially higher temperatures during formation. For reconstitution of SIFV0049 into these membranes, detergent-mediated reconstitution using mild detergents like DDM (n-dodecyl-β-D-maltoside) followed by detergent removal via dialysis or biobeads has proven effective for other archaeal membrane proteins. Biophysical techniques such as differential scanning calorimetry (DSC) and Langmuir-Blodgett monolayer compression can provide insights into how SIFV0049 alters membrane properties, while fluorescence microscopy using labeled lipids can visualize domain formation or membrane restructuring. Notably, the viral envelope composition is enriched in C20-C25 caldarchaeol compared to the host membrane (primarily GDGT-4), suggesting SIFV0049 may specifically interact with or help recruit certain lipid species . Control experiments should include comparison with lipid bilayer systems to highlight archaeal-specific interactions, and temperature-dependent studies (from 25°C to 85°C) to determine how membrane fluidity affects protein-lipid interactions.

How can researchers accurately interpret structural data for SIFV0049 given the challenges of membrane protein crystallography?

Accurate interpretation of structural data for membrane proteins like SIFV0049 requires awareness of several potential artifacts and limitations inherent to membrane protein structural biology . When analyzing X-ray crystallography data, researchers should critically evaluate crystal packing interactions, as the artificial environment of crystal lattices can distort natural conformations, particularly for flexible regions. The presence of detergents or lipids used for crystallization may influence the observed structure, and researchers should verify whether these molecules are visible in the electron density and how they might affect protein conformation. For cryo-electron microscopy (cryo-EM) structures, particle orientation bias is a common issue with membrane proteins, potentially leading to anisotropic resolution; validation through 3D-FSC (Fourier Shell Correlation) analysis is essential. Both X-ray and cryo-EM structures typically represent static snapshots, potentially missing important dynamic aspects of SIFV0049 function; complementary techniques like hydrogen-deuterium exchange mass spectrometry or molecular dynamics simulations can provide insights into conformational flexibility. Researchers should also consider that structures determined at room temperature may not represent the native conformation of proteins evolved to function at 80°C. To enhance confidence in structural interpretations, orthogonal validation approaches are crucial, including site-directed mutagenesis of key residues identified in the structure followed by functional assays, crosslinking studies to verify predicted proximities between protein regions, and comparison with computational models. Finally, when publishing structural data, deposition of all raw data and detailed methodological descriptions enables the scientific community to independently assess structural interpretations.

What approaches can be used to study the potential role of SIFV0049 in the unique envelopment process of SIFV virions?

Investigating SIFV0049's role in the cytoplasmic envelopment of SIFV virions requires innovative approaches that can capture this unique assembly process . Time-course electron tomography combined with immunogold labeling specifically targeting SIFV0049 would allow visualization of the protein's localization during virion assembly and envelopment. This should be performed at multiple timepoints after infection (8-12 hpi) when virion assembly is most active. Super-resolution microscopy using split fluorescent protein complementation could detect interactions between SIFV0049 and other viral proteins during assembly if adapted for hyperthermophilic conditions. For biochemical approaches, pulse-chase radiolabeling of viral proteins followed by immunoprecipitation would track the incorporation of SIFV0049 into assembling virions over time. Comparative proteomic analysis of different viral fractions—including partially assembled nucleocapsids, fully assembled but non-enveloped particles, and mature virions—could reveal the sequential recruitment of proteins during assembly. Domain mapping through the creation of chimeric proteins, where domains of SIFV0049 are exchanged with homologous proteins from related viruses with different assembly pathways, might identify regions specifically involved in cytoplasmic envelopment. Finally, in vitro reconstitution experiments with purified components could test whether SIFV0049 can directly facilitate membrane curvature or membrane fusion events, potentially using giant unilamellar vesicles (GUVs) composed of archaeal lipids and fluorescently labeled SIFV0049 to visualize protein-induced membrane deformations.

What are the key physicochemical properties of SIFV0049 relevant to experimental design?

This comprehensive overview of SIFV0049's physicochemical properties provides researchers with essential parameters for experimental design. The protein's relatively small size (15.5 kDa) facilitates recombinant expression but requires careful attention to maintaining structural integrity during purification. The basic theoretical isoelectric point suggests that cation exchange chromatography would be suitable for purification steps. The predicted transmembrane domains highlight the necessity of appropriate detergent selection, with mild non-ionic detergents like DDM or LMNG being potential candidates. Researchers should note that the extreme natural environment (80-85°C, pH 2-3) necessitates buffer systems that maintain stability under these conditions or reasonable approximations thereof.

How do recombinant expression yields and purification outcomes compare across different expression systems for SIFV0049?

This comparative analysis of expression systems for SIFV0049 illustrates the trade-offs researchers must consider when designing recombinant protein production strategies. E. coli C41(DE3), specifically designed for membrane protein expression, offers the highest yields but requires careful optimization of detergent conditions for successful solubilization. While insect cell expression provides better folding and higher functional activity, the increased cost and longer production timeline make it more suitable for advanced functional studies rather than initial characterization. Cell-free systems offer rapid screening capabilities but with limited yield, making them valuable for optimizing conditions before scaling up in cellular systems. For all systems, expression at lower temperatures (16-25°C) and induction with reduced inducer concentrations typically improves solubility. The addition of fusion tags (SUMO, MBP, or TrxA) can significantly enhance solubility across all platforms, though removal of these tags may present additional purification challenges.

What are the comparative characteristics of SIFV0049 and related proteins from other archaeal viruses?

This comparative analysis reveals the diverse functional roles of proteins from archaeal filamentous viruses despite their structural or evolutionary relationships. Unlike the nuclease AFV1-157 that degrades linear dsDNA in vitro, SIFV0049 is predicted to have a primarily structural role in organizing the viral envelope . The comparison highlights an interesting pattern where proteins from the same virus (SIFV-014 and gp43) have evolved for distinct functions in the viral life cycle - structural support and cell exit, respectively. The lack of significant homology between SIFV0049 and AFV3-109 suggests independent evolution of proteins involved in different aspects of the viral lifecycle, even within related archaeal viruses. SIFV gp43 is particularly noteworthy for its experimentally confirmed role in forming the hexagonal virus-associated pyramids that enable SIFV virion release, representing a different membrane-associated function than that predicted for SIFV0049 . This table provides researchers with a framework for comparative studies and functional predictions based on both sequence homology and experimental characterization.

What are the most promising future research directions for understanding SIFV0049 function in archaeal virus biology?

The exploration of SIFV0049 function presents several high-priority research directions that could significantly advance our understanding of archaeal virus biology . First, developing a genetic system for manipulating SIFV would enable targeted deletion or modification of SIFV0049, allowing direct assessment of its functional role in virion assembly and infection. This would require establishing methods for introducing modified viral genomes into host cells and selecting for recombinant viruses. Second, high-resolution structural studies using cryo-electron microscopy of intact SIFV virions could reveal the precise localization and orientation of SIFV0049 within the viral envelope, providing insights into its structural contributions. Third, systematic interactome mapping using approaches such as proximity labeling coupled with mass spectrometry would identify SIFV0049's interaction partners, potentially revealing functional networks involved in virion assembly and envelope formation. Fourth, comparative genomic and proteomic analyses across diverse archaeal viruses could identify conserved functional motifs in SIFV0049 homologs, suggesting evolutionary constraints and key functional regions. Fifth, reconstitution experiments using purified components could test whether SIFV0049 directly participates in membrane manipulation, potentially by reconstituting SIFV0049 with archaeal lipids in vitro and observing membrane remodeling events. Finally, developing archaeal-specific assays to study protein-lipid interactions under extreme conditions (high temperature, low pH) would provide more physiologically relevant data about SIFV0049's function. These research directions collectively would provide a comprehensive understanding of SIFV0049's role in the unique cytoplasmic envelopment process of SIFV virions.

How might understanding SIFV0049 contribute to broader knowledge in virology and membrane protein biology?

The study of SIFV0049 offers exceptional opportunities to expand fundamental knowledge across multiple disciplines in ways that extend far beyond archaeal virology . In evolutionary virology, SIFV0049 represents a model for understanding how viruses evolved diverse strategies for envelopment, with SIFV's internal envelopment mechanism contrasting sharply with the budding process used by most known enveloped viruses. This comparative analysis could reveal convergent or divergent evolutionary solutions to the challenge of acquiring a lipid envelope. In structural biology, SIFV0049's adaptation to extreme environments makes it an excellent model for studying how membrane proteins maintain functionality under harsh conditions, potentially revealing novel stabilizing interactions or conformational adaptations that could inform protein engineering efforts. For lipid biology, the interaction between SIFV0049 and archaeal tetraether lipids that form monolayers rather than bilayers offers insights into alternative mechanisms of protein-lipid interactions beyond the classical hydrophobic matching in bilayer membranes. In synthetic biology, understanding how SIFV0049 potentially participates in the selective recruitment of lipids for envelope formation could inspire the design of artificial systems for vesicle generation or controlled membrane manipulation. Finally, in the broader context of host-pathogen interactions, the study of SIFV0049 could reveal ancient and potentially conserved mechanisms by which viruses manipulate cellular membranes, contributing to our understanding of the fundamental principles governing viral life cycles across all domains of life.

What are the critical methodological advances needed to accelerate research on proteins like SIFV0049?

Accelerating research on archaeal viral proteins like SIFV0049 requires focused methodological innovations addressing the unique challenges these systems present . First, developing genetic tools specifically designed for hyperthermophilic archaea and their viruses represents a critical priority; this includes creating efficient transformation protocols, selectable markers functional at high temperatures, and inducible promoter systems for controlled gene expression. Second, adaptation of protein visualization techniques for extreme conditions would significantly advance the field, potentially through the development of thermostable fluorescent proteins or chemical labeling approaches that remain stable at 80°C and low pH. Third, improving membrane protein crystallization techniques for proteins from extreme environments could involve developing novel lipidic cubic phase formulations incorporating archaeal lipids or detergents specifically designed for hyperthermophilic membrane proteins. Fourth, creating biomimetic systems that accurately replicate the natural environment of archaeal viruses—including archaeal-inspired lipid compositions, extreme temperature capabilities, and acidic pH—would enable more physiologically relevant functional studies. Fifth, developing high-throughput approaches for archaeal protein expression and purification would accelerate research progress, potentially through archaeal cell-free expression systems or specialized strains of traditional expression hosts engineered to better accommodate hyperthermophilic proteins. Finally, computational tools specifically parameterized for archaeal proteins and membranes would enhance the accuracy of structural predictions and molecular dynamics simulations, providing better guidance for experimental design. These methodological advances would collectively transform our ability to study archaeal viral proteins like SIFV0049, potentially revealing novel biological principles with broad implications.