Recombinant Sulfolobus islandicus filamentous virus Uncharacterized protein 51 (SIFV0051)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SIFV0051; Uncharacterized protein 51
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) (SIFV)
Target Names
SIFV0051
Target Protein Sequence
MSYTTPTYTASVSNDILRYMMAYATGNDGCIQSMSALFQSSGESIIAYNVSASSTTQAGF FFQLQNVPQGIGVQIVFFSTTIPQNTFFIDLRFTTTQGNTYQLAQVNTLPPNTNYALVII VSLTITVQPASNVNISPLLQAFTSFASNQCATAQPPSLSYTGNGFTVFYENTYTSGITFN AILIAQNTLTSSNTIQITATINGNVVATATISTPALGYAYFLFTLTLVFTSE
Uniprot No.

Target Background

Database Links

KEGG: vg:922317

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is SIFV0051 and what is known about its structural characteristics?

SIFV0051 is an uncharacterized protein from the Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi), consisting of 232 amino acids. The protein is identified by the UniProt ID Q914I1 and has a full amino acid sequence that begins with MSYTTPTYTASVSNDILRY and ends with FTLTLVFTSE .

As an uncharacterized protein, detailed structural information remains limited. Current recombinant versions of this protein typically include an N-terminal His-tag to facilitate purification processes . Preliminary structural analysis would likely require techniques such as circular dichroism spectroscopy to determine secondary structure elements, and more advanced methods like X-ray crystallography or cryo-electron microscopy would be necessary for resolving the three-dimensional structure.

The protein contains regions that may form secondary structures based on sequence analysis, though experimental verification of these predictions should be considered a priority research direction for teams working with SIFV0051.

What expression systems are suitable for producing recombinant SIFV0051?

E. coli expression systems have been successfully used to produce recombinant SIFV0051 protein with N-terminal His-tags . When selecting an expression system, researchers should consider several factors:

  • Codon optimization: Since SIFV0051 comes from an archaeal virus, codon optimization for E. coli expression may be necessary to overcome potential expression challenges due to codon rarity .

  • Expression vector selection: Vectors with tightly controlled promoters are recommended as some viral proteins may be toxic to the host cells.

  • Fusion tag placement: The current commercially available recombinant SIFV0051 utilizes an N-terminal His-tag , though researchers may need to experiment with different tag positions or types if expression or solubility issues arise.

  • Expression conditions: Optimization of induction temperature, IPTG concentration, and duration is crucial for maximizing protein yield while maintaining proper folding.

Alternative expression systems such as yeast or insect cells could be considered if E. coli expression results in insoluble protein or improper folding, though these would require additional optimization and validation steps.

What are the recommended storage and reconstitution protocols for lyophilized SIFV0051?

Lyophilized recombinant SIFV0051 should be stored at -20°C to -80°C upon receipt . Before opening, the vial should be briefly centrifuged to bring the contents to the bottom.

For reconstitution, the following protocol is recommended:

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Add glycerol to a final concentration of 5-50% to enhance stability during freezing (50% is the standard recommendation) .

  • Aliquot the reconstituted protein for long-term storage at -20°C or -80°C to avoid repeated freeze-thaw cycles, which can compromise protein integrity .

For working stocks, store aliquots at 4°C for up to one week . It's important to note that repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

The reconstituted protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 , which helps maintain protein stability.

What approaches can be used to investigate the potential function of SIFV0051?

As an uncharacterized protein, determining the function of SIFV0051 requires a multi-faceted approach:

  • Sequence-based prediction: Employ bioinformatics tools to identify conserved domains, motifs, or structural similarities with proteins of known function. While lacking direct information about SIFV0051, this approach has been successful with other viral proteins .

  • Structural characterization: As mentioned in full-length protein research, determining the three-dimensional structure can provide insights into functional regions . Methods including X-ray crystallography, nuclear magnetic resonance (NMR), or cryo-electron microscopy would be appropriate.

  • Protein-protein interaction studies: Co-immunoprecipitation (Co-IP) assays, similar to those used in case studies of other proteins , can identify binding partners within the host cell or viral proteins, suggesting potential functional pathways.

  • Gene knockout/knockdown studies: If possible, genetic manipulation of the viral genome to create SIFV0051-deficient virus can reveal phenotypic changes indicating function.

  • Heterologous expression: Expressing SIFV0051 in archaeal host cells and observing cellular changes can provide functional clues.

  • Mass spectrometry analysis: This can identify post-translational modifications that might regulate protein function.

These approaches should be employed in parallel rather than sequentially to build a comprehensive understanding of SIFV0051's potential role in viral infection or replication.

How can researchers design experiments to investigate SIFV0051 interactions with host cell proteins?

Investigating protein-protein interactions between SIFV0051 and host cell proteins requires careful experimental design:

  • Pull-down assays: Using the His-tagged recombinant SIFV0051 as bait, researchers can identify potential archaeal host binding partners. This requires:

    • Immobilizing the His-tagged SIFV0051 on Ni-NTA resin

    • Incubating with archaeal cell lysates

    • Washing to remove non-specific interactions

    • Eluting bound proteins and analyzing by mass spectrometry

  • Co-immunoprecipitation: Similar to techniques described in case studies for other proteins , this approach requires:

    • Generation of specific antibodies against SIFV0051

    • Precipitation of SIFV0051 from infected cells

    • Identification of co-precipitated proteins

  • Yeast two-hybrid screening: Though technically challenging with archaeal proteins, modified Y2H systems could be employed to screen for interactions.

  • Proximity-dependent labeling: BioID or APEX2 fusions with SIFV0051 expressed in archaeal hosts can identify proximal proteins in the native cellular environment.

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST): These biophysical methods can quantify binding affinities between SIFV0051 and candidate interacting proteins.

Validation of identified interactions should include reciprocal Co-IP experiments and functional assays to determine the biological significance of these interactions.

What strategies can be employed to overcome challenges in expressing full-length SIFV0051 for structural studies?

Full-length protein expression for structural studies presents several challenges that can be addressed through specific strategies:

  • Addressing expression challenges:

    • Analyze the protein sequence for hydrophobicity and rare codons that might affect expression in E. coli systems

    • Use specialized E. coli strains (such as Rosetta for rare codons or C41/C43 for potentially toxic proteins)

    • Consider fusion partners beyond His-tags, such as MBP, GST, or SUMO, which can enhance solubility

    • Experiment with induction conditions (temperature, inducer concentration, duration)

  • Preventing truncated products:

    • Design expression vectors with fusion tags at both N- and C-termini to ensure selection of full-length products

    • Include protease inhibitors during purification

    • Optimize purification protocols with increasing imidazole concentration gradients during elution

  • Enhancing protein stability:

    • Perform thermal shift assays to identify buffer conditions that maximize protein stability

    • Add stabilizing agents such as trehalose (already used in commercial preparations)

    • Consider protein engineering approaches to remove flexible regions that might hinder crystallization

  • Alternative expression systems:

    • If E. coli expression is problematic, consider archaeal expression systems that might better accommodate the native folding environment of this archaeal viral protein

    • Insect cell expression systems may provide better post-translational processing

These approaches should be systematically tested and optimized based on initial results to determine the most effective strategy for obtaining sufficient quantities of properly folded SIFV0051 for structural studies.

How can researchers validate that recombinant SIFV0051 maintains native structural properties?

Validating that recombinant SIFV0051 maintains native structural properties is essential for meaningful functional studies. Researchers can employ several complementary approaches:

  • Circular dichroism (CD) spectroscopy:

    • Analyze secondary structure elements (α-helices, β-sheets)

    • Compare spectra under different buffer conditions to identify optimal stability

  • Thermal shift assays:

    • Measure protein stability and folding through fluorescence-based thermal denaturation

    • Identify buffer conditions that best maintain the native state

  • Limited proteolysis:

    • Expose the protein to controlled proteolytic digestion

    • Well-folded domains typically show resistance to proteolysis

    • Compare digestion patterns of recombinant versus native protein (if available)

  • Dynamic light scattering (DLS):

    • Assess protein homogeneity and detect aggregation

    • Monitor stability over time under different storage conditions

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS):

    • Determine the oligomeric state of the recombinant protein

    • Verify consistency with predicted native oligomerization

  • Functional assays:

    • Develop biochemical or cell-based assays to test functional activity

    • Compare activity of recombinant protein to native virus-produced protein if possible

When validating structural integrity, it's important to remember that the His-tag present on the recombinant protein might affect certain properties, so creating constructs with removable tags may be necessary for definitive structural studies.

What purification strategy should be employed for obtaining high-purity SIFV0051 suitable for structural studies?

A multi-step purification strategy is recommended for obtaining high-purity SIFV0051 for structural studies:

  • Initial capture using immobilized metal affinity chromatography (IMAC):

    • Exploit the N-terminal His-tag present on recombinant SIFV0051

    • Use a gradient elution with increasing imidazole concentration to minimize co-purification of contaminants

    • Consider on-column refolding if the protein is expressed in inclusion bodies

  • Intermediate purification using ion exchange chromatography:

    • Select cation or anion exchange based on the protein's theoretical isoelectric point

    • Optimize salt gradient to achieve maximum separation from contaminants

  • Polishing step using size exclusion chromatography:

    • Remove aggregates and ensure monodispersity

    • Simultaneously perform buffer exchange into a stabilizing buffer containing 6% trehalose as used in commercial preparations

  • Quality control assessments:

    • SDS-PAGE with Coomassie staining to verify purity (aim for >95% purity)

    • Western blot with anti-His antibodies to confirm identity

    • Mass spectrometry to verify the intact mass and sequence coverage

    • Dynamic light scattering to assess homogeneity

  • Concentration and storage:

    • Concentrate using centrifugal concentrators with appropriate molecular weight cut-off

    • Store with 50% glycerol at -80°C in small aliquots to prevent freeze-thaw damage

Monitor protein stability at each purification step, as some proteins can lose structural integrity during the purification process, especially during concentration steps.

How should researchers design assays to investigate potential enzymatic activities of SIFV0051?

Designing assays to investigate potential enzymatic activities of SIFV0051 requires a systematic approach:

  • Predict potential enzymatic functions:

    • Perform detailed sequence analysis and structural prediction to identify catalytic motifs

    • Compare with related archaeal viral proteins with known functions

    • Consider common viral enzymatic activities (proteases, nucleases, DNA/RNA modifying enzymes)

  • Design general activity screening assays:

    • Nuclease activity: Incubate SIFV0051 with different nucleic acid substrates (ssDNA, dsDNA, RNA) and analyze degradation patterns

    • Protease activity: Use fluorogenic peptide substrates with various recognition sequences

    • DNA/RNA binding: Employ electrophoretic mobility shift assays (EMSA) with different nucleic acid substrates

    • ATPase/GTPase activity: Monitor phosphate release using colorimetric assays

  • Optimize assay conditions:

    • Test activity across pH range (pH 2-10)

    • Vary temperature (room temperature to 80°C, considering the thermophilic origin)

    • Test different metal cofactors (Mg2+, Mn2+, Zn2+, Ca2+)

    • Include relevant archaeal lipids or membrane components

  • Controls and validation:

    • Include heat-denatured SIFV0051 as negative control

    • Use site-directed mutagenesis to alter predicted catalytic residues

    • Include known enzymes with similar predicted activities as positive controls

  • Advanced characterization:

    • For confirmed activities, determine kinetic parameters (Km, Vmax, kcat)

    • Assess substrate specificity using structurally related substrates

    • Identify inhibitors to further characterize the active site

Since SIFV0051 originates from a thermophilic archaeal virus, consider performing assays at elevated temperatures (60-80°C) that mimic the native environment of Sulfolobus islandicus.

What approaches can resolve contradictory data when characterizing SIFV0051?

When facing contradictory data during SIFV0051 characterization, researchers should employ systematic troubleshooting and validation approaches:

  • Verify protein integrity:

    • Confirm protein identity through mass spectrometry

    • Assess protein stability and homogeneity using techniques such as DLS and native PAGE

    • Check for degradation products using western blot with antibodies against N- and C-terminal tags

  • Systematically vary experimental conditions:

    • Test different buffer compositions, pH values, and ionic strengths

    • Vary temperature conditions, considering the thermophilic origin of the virus

    • Assess the effect of different additives like reducing agents or cofactors

  • Use complementary methodologies:

    • If structural data is contradictory, employ multiple structural analysis techniques (X-ray crystallography, NMR, cryo-EM)

    • For functional studies, apply both in vitro and in vivo approaches

    • Validate interactions using reciprocal pull-downs and different tagging strategies

  • Consider protein modifications:

    • Check for post-translational modifications using mass spectrometry

    • Evaluate the impact of the His-tag by creating constructs with different tags or tag-free versions

    • Assess oligomerization state under different conditions

  • Statistical validation:

    • Increase biological and technical replicates

    • Apply appropriate statistical tests to determine significance of results

    • Use robust statistical methods such as those outlined in research validation frameworks

  • Independent verification:

    • Have different laboratory members replicate critical experiments

    • Collaborate with other research groups for independent validation

    • Consider using different batches of protein or expression systems

When publishing results that contain initially contradictory data, clearly document the troubleshooting process and explain how discrepancies were resolved to enhance reproducibility for other researchers.

How can researchers design meaningful negative controls for SIFV0051 functional studies?

Designing appropriate negative controls is crucial for ensuring the validity of functional studies with SIFV0051:

  • Protein-based negative controls:

    • Heat-denatured SIFV0051: Heat the protein to 95°C for 10 minutes to destroy structure while maintaining the same protein composition

    • Site-directed mutants: Create mutant versions of SIFV0051 with alterations in predicted functional residues

    • Truncated variants: Express partial protein constructs lacking predicted functional domains

    • Irrelevant protein control: Use an unrelated protein with similar size and purification method (e.g., another His-tagged protein)

  • Buffer and reaction controls:

    • Buffer-only control: Include samples with all components except SIFV0051

    • Vehicle control: If SIFV0051 is stored in special buffers with trehalose or glycerol , include these components without protein

    • Time-zero control: Sample taken immediately after adding SIFV0051 to reaction mixture

  • Expression system controls:

    • Empty vector control: Process cells transformed with expression vector lacking the SIFV0051 insert through the same purification protocol

    • Host cell lysate control: Use purified material from non-transformed E. coli to control for host cell contaminants

  • Experimental design controls:

    • Randomization of sample processing order

    • Blinding of sample identity during analysis when possible

    • Inclusion of positive controls (known proteins with similar expected activities)

  • Validation controls:

    • Dose-response relationship: Test multiple concentrations of SIFV0051 to establish specificity

    • Inhibitor controls: If specific inhibitors are identified, use them to confirm activity specificity

What statistical approaches are appropriate for analyzing SIFV0051 interaction data?

When analyzing SIFV0051 interaction data, researchers should employ rigorous statistical approaches tailored to the specific experimental methodology:

  • For physical interaction studies (pull-downs, Co-IP):

    • Apply fold-enrichment calculations comparing bait vs. control samples

    • Use specialized software like SAINTexpress or MiST for mass spectrometry interaction data

    • Implement false discovery rate (FDR) corrections for multiple testing

    • Consider using volcano plots to visualize significance and fold-change simultaneously

  • For binding affinity measurements (SPR, ITC, MST):

    • Fit binding curves using appropriate models (1:1 binding, cooperative binding)

    • Calculate confidence intervals for derived parameters (KD, kon, koff)

    • Use residual analysis to assess goodness of fit

    • Perform replicate measurements (minimum of three) to establish reproducibility

  • For high-throughput screening data:

    • Calculate Z'-factor to assess assay quality and separation between positive and negative controls

    • Apply robust statistics resistant to outliers (median, MAD instead of mean, SD)

    • Use appropriate normalization methods to account for plate effects

    • Consider utilizing research validation frameworks for quantitative analysis

  • For structural data analysis:

    • Apply crystallographic statistics (R-factor, R-free) for X-ray data

    • Use RMSD calculations for structural comparisons

    • Employ Ramachandran plot analysis for structure validation

  • For comparative studies:

    • Use ANOVA with appropriate post-hoc tests for multi-group comparisons

    • Apply non-parametric tests when normality cannot be assumed

    • Consider mixed-effect models for data with nested structure

Regardless of the specific approach, transparent reporting of all statistical methods, including software packages, versions, and parameters used, is essential for reproducibility. Researchers should also consider pre-registering analysis plans for complex studies to minimize bias in interpretation.

How can researchers distinguish between specific and non-specific interactions when studying SIFV0051?

Distinguishing specific from non-specific interactions is a critical challenge when studying uncharacterized proteins like SIFV0051:

  • Experimental approaches:

    • Competition assays: Test if unlabeled SIFV0051 can compete with labeled protein for binding

    • Dose-response relationships: True interactions typically show saturation kinetics

    • Mutational analysis: Specific interactions are disrupted by mutations in binding interfaces

    • Cross-linking experiments: Use chemical cross-linkers of different lengths to identify proximities

    • Salt sensitivity: Gradually increase ionic strength to disrupt electrostatic non-specific interactions

    • Detergent sensitivity: Low concentrations of mild detergents can disrupt hydrophobic non-specific interactions

  • Control proteins:

    • Use structurally similar but functionally unrelated proteins as negative controls

    • Create surface-charge variants of SIFV0051 by mutagenesis

    • Compare binding profiles of different domains of SIFV0051 if possible

  • Quantitative filters:

    • Implement stringent statistical thresholds (adjusted p-values <0.01)

    • Apply fold-change cutoffs based on empirical distributions

    • Use SILAC or TMT labeling for quantitative proteomics to establish clear enrichment thresholds

  • Validation through orthogonal methods:

    • Confirm key interactions using at least two independent methodologies

    • Validate in vitro findings with in vivo approaches when possible

    • Perform reciprocal pull-downs (if antibodies are available)

  • Bioinformatic analysis:

    • Check for evolutionary conservation of binding interfaces

    • Look for co-evolution patterns between SIFV0051 and potential partners

    • Use protein-protein interaction prediction algorithms to prioritize candidates

When interpreting results, consider the biological context and functional relevance of identified interactions. Interactions that make biological sense in the context of viral replication or host-pathogen interactions are more likely to be specific and functionally important.

What bioinformatic tools are most appropriate for predicting SIFV0051 function based on sequence and structural data?

A comprehensive bioinformatic analysis of SIFV0051 should employ multiple tools to predict potential functions:

  • Sequence-based analysis:

    • PSI-BLAST and HHpred for detecting remote homology

    • InterProScan for identifying functional domains and motifs

    • SignalP for signal peptide prediction

    • TMHMM for transmembrane domain prediction

    • NetPhos for phosphorylation site prediction

    • PredictProtein for comprehensive sequence-based feature prediction

  • Structural prediction and analysis:

    • AlphaFold2 for protein structure prediction with high accuracy

    • I-TASSER for alternative structural models

    • ConSurf for mapping evolutionary conservation onto structures

    • CASTp for prediction of binding pockets and cavities

    • ProFunc for structure-based function prediction

    • Dali server for structural similarity searches

  • Interaction prediction:

    • STRING database for predicted functional associations

    • PSOPIA for protein-protein interaction prediction

    • BindUP for nucleic acid binding prediction

    • PredictSNP for analyzing effects of mutations

  • Integrative approaches:

    • COFACTOR for integrating structure, sequence, and protein-protein interactions

    • ProteinsPlus web server for comprehensive structure-based analysis

    • GeneSilico Metaserver for consensus predictions from multiple tools

  • Archaeal virus-specific resources:

    • pVOGs (prokaryotic Virus Orthologous Groups) database

    • Archaeal Virus DB for comparison with related archaeal virus proteins

When using these tools, researchers should:

  • Compare results across multiple tools to identify consensus predictions

  • Consider the confidence scores provided by each tool

  • Validate computational predictions with targeted experimental approaches

  • Remain aware that novel viral proteins may have functions not well-represented in current databases

These bioinformatic approaches provide valuable hypotheses about SIFV0051 function that can guide experimental design, but conclusive functional assignment ultimately requires experimental validation.

How should researchers report SIFV0051 structural data to ensure reproducibility?

Ensuring reproducibility in structural studies of SIFV0051 requires comprehensive reporting of both experimental methods and results:

  • Sample preparation details:

    • Complete expression construct sequence including vector, tags, and linkers

    • Detailed expression conditions (strain, media, temperature, induction method)

    • Step-by-step purification protocol with buffer compositions

    • Final protein concentration, purity assessment, and storage conditions

    • Lot number of commercial protein if used

  • Experimental methods:

    • For X-ray crystallography: crystallization conditions, cryoprotection, data collection parameters, processing software

    • For NMR: sample conditions, acquisition parameters, pulse sequences

    • For cryo-EM: sample preparation, microscope settings, image processing workflow

    • For spectroscopic methods: instrument specifications, data acquisition parameters

  • Data processing and analysis:

    • Software packages and versions used

    • All parameters and settings applied during processing

    • Validation statistics and quality metrics

    • Raw data availability statement (deposition in public repositories)

  • Results reporting:

    • Deposit coordinates in the Protein Data Bank (PDB)

    • Include validation reports from tools like MolProbity

    • Provide electron density maps or NMR restraints

    • Include representative images of raw data (diffraction patterns, micrographs)

  • Validation information:

    • Ramachandran statistics

    • R-factors and resolution for crystallography

    • RMSD values for NMR ensembles

    • Resolution and FSC curves for cryo-EM

  • Transparent discussion of limitations:

    • Missing regions or disordered segments

    • Alternative conformations considered

    • Model ambiguities or uncertainties

    • Impact of experimental conditions on structure

Following reporting guidelines such as those from the wwPDB or specific journals, and using structured reporting formats like those suggested in research validation frameworks , enhances reproducibility. Consider using workflow management systems and electronic laboratory notebooks to document procedures comprehensively.

What are potential applications of SIFV0051 in archaeal biology research?

As an uncharacterized protein from an archaeal virus, SIFV0051 offers several promising applications in archaeal biology research:

  • Host-pathogen interaction studies:

    • Use purified SIFV0051 to identify host cell receptors or binding partners

    • Develop it as a potential tool to study Sulfolobus islandicus cell surface or membrane properties

    • Investigate viral entry mechanisms in extremophilic archaea

  • Extremophile protein biology:

    • Study SIFV0051 as a model for protein stability under extreme conditions

    • Investigate folding and stability mechanisms in proteins from hyperthermophilic organisms

    • Compare structural features with mesophilic viral proteins to identify thermostability determinants

  • Archaeal virus taxonomy and evolution:

    • Use SIFV0051 sequence and structural data to improve classification of archaeal viruses

    • Perform comparative genomics to trace evolutionary relationships between archaeal viruses

    • Identify conserved functional domains across archaeal viral proteins

  • Development of archaeal genetic tools:

    • If SIFV0051 has DNA/RNA binding or modifying activities, it could be developed into molecular biology tools specific for archaeal systems

    • Potential use in developing archaeal expression systems or reporters

  • Structural biology advancements:

    • Contribute to understanding of protein structure in extremophiles

    • Add to the limited structural database for archaeal viral proteins

    • Provide insights into protein adaptation to extreme environments

These applications would advance understanding of archaeal biology, which remains less studied compared to bacterial and eukaryotic systems, while potentially yielding tools specific for working with extremophilic organisms. Future research could focus on determining if SIFV0051 has enzymatic activities that could be harnessed for biotechnology applications in high-temperature environments.

How might researchers investigate the role of SIFV0051 in viral replication cycle?

Investigating SIFV0051's role in the viral replication cycle requires a systematic approach targeting different stages of infection:

  • Viral attachment and entry:

    • Develop fluorescently-labeled SIFV0051 to track localization during infection

    • Create antibodies against SIFV0051 for immunolocalization studies

    • Perform binding assays between purified SIFV0051 and host cell surface components

    • Test if pre-treatment with anti-SIFV0051 antibodies inhibits viral infection

  • Temporal expression analysis:

    • Perform time-course analysis of SIFV0051 expression during infection

    • Use RT-qPCR to monitor transcript levels at different infection stages

    • Employ western blotting to track protein abundance through the infection cycle

    • Correlate expression timing with specific viral replication events

  • Localization studies:

    • Use immunofluorescence microscopy to determine subcellular localization

    • Perform cellular fractionation followed by western blotting

    • Consider cryo-electron tomography for visualization in the native context

    • Track changes in localization throughout the infection cycle

  • Functional inhibition approaches:

    • Develop CRISPR interference systems adapted for archaeal viruses

    • Design antisense oligonucleotides targeting SIFV0051 mRNA

    • Screen for small molecule inhibitors of SIFV0051 if function is identified

    • Assess impact of inhibition on viral replication efficiency

  • Protein-protein interaction network:

    • Identify viral and host interaction partners through Co-IP/MS approaches

    • Map the temporal dynamics of these interactions during infection

    • Create an interaction network to position SIFV0051 within the viral replication machinery

  • Genetic approaches:

    • Attempt to create SIFV0051 deletion mutants if genetic systems exist

    • Perform complementation studies with mutant variants

    • Use transposon mutagenesis to identify genetic interactions

These approaches should be conducted in appropriate hyperthermophilic conditions mimicking the natural environment of Sulfolobus islandicus, ideally at temperatures around 75-80°C and acidic pH (pH 2-3) to maintain relevant biological activity.

What emerging technologies could advance our understanding of SIFV0051 function and structure?

Several cutting-edge technologies could significantly advance our understanding of SIFV0051:

  • Advanced structural biology approaches:

    • Micro-electron diffraction (MicroED) for structural determination from nanocrystals

    • Serial femtosecond crystallography using X-ray free-electron lasers for room-temperature structures

    • Cryo-electron tomography for visualizing SIFV0051 in the context of virus particles or infected cells

    • Integrative structural biology combining multiple data types (SAXS, NMR, cryo-EM)

  • Protein dynamics and interaction technologies:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map protein dynamics and interactions

    • Single-molecule FRET to observe conformational changes during function

    • Native mass spectrometry for detecting complexes and binding partners

    • AlphaFold-Multimer for predicting protein-protein interaction structures

  • Functional genomics approaches:

    • CRISPR interference systems adapted for archaeal viruses

    • RNA-seq and Ribo-seq to monitor transcriptional and translational changes

    • Transposon sequencing (Tn-seq) for high-throughput functional screening

    • Metatranscriptomics of natural archaeal virus populations

  • Advanced imaging:

    • Super-resolution microscopy adapted for extremophile organisms

    • Correlative light and electron microscopy (CLEM) for linking function to structure

    • Live-cell imaging under extreme conditions

  • Computational approaches:

    • Molecular dynamics simulations at elevated temperatures

    • Deep learning for function prediction from sequence/structure

    • Quantum mechanics/molecular mechanics (QM/MM) for enzyme mechanism studies if enzymatic activity is discovered

  • High-throughput screening:

    • Automated crystallization and structure determination pipelines

    • Activity-based protein profiling to identify substrates

    • Microfluidic approaches for testing conditions at extremophile temperatures

These technologies, particularly when used in combination, could provide unprecedented insights into the structure, dynamics, and function of SIFV0051 within its viral context. Researchers should also consider applying validation frameworks like RIVF to ensure the reliability and reproducibility of results obtained with these emerging technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.