Recombinant Sulfolobus islandicus rod-shaped virus 1 Uncharacterized protein 510 (510)

What is the amino acid sequence of SIRV-1 uncharacterized protein 510?

The amino acid sequence of SIRV-1 uncharacterized protein 510 is FIKSIMYDIYIHYAICKFIFLLEIYKLIAMGKRKGQRNIA as documented in the UniProt database (Q8QL30) . This 39-amino acid sequence has not been extensively characterized structurally, unlike some other archaeal viral proteins. When designing experiments involving this protein, researchers should consider its relatively short length, which may influence structural stability and functionality.

What expression systems are most effective for producing recombinant archaeal viral proteins like SIRV-1 protein 510?

Based on studies with related archaeal viral proteins, E. coli expression systems using MBP-fusion constructs have demonstrated high success rates. For instance, a study examining HEV proteins (though from a different viral family) achieved yields of approximately 120 mg of soluble protein per liter of unlabeled medium using an MBP-fusion approach . This strategy enhances solubility while maintaining proper protein folding, which is particularly important for structural and functional studies of viral proteins. For SIRV-1 protein 510 specifically, similar fusion-based expression systems would likely be beneficial, especially considering its small size.

What buffer conditions are recommended for storage of recombinant SIRV-1 protein 510?

The recommended storage conditions for recombinant SIRV-1 protein 510 include a Tris-based buffer with 50% glycerol, optimized specifically for this protein . Storage should be at -20°C for regular use, while long-term storage is recommended at -20°C or -80°C. To maintain protein integrity, repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week . These conditions help preserve protein structure and functionality for experimental applications.

What crystallization approaches might be effective for determining the structure of SIRV-1 protein 510?

While there are no published crystal structures specifically for SIRV-1 protein 510, methodological insights can be drawn from successful crystallization of other archaeal viral proteins. A systematic approach involving screening multiple conditions is recommended. For example, in the crystallization of a hepatitis E viral protein, researchers screened 864 different crystallization conditions at two temperatures (4°C and 20°C) . Initial hits were obtained with conditions containing PEG 3350, LiNO₃, and NiCl₂ . For SIRV-1 protein 510, a similar comprehensive screening approach should be employed, with special attention to conditions that have proven successful for small viral proteins.

What NMR techniques are most appropriate for analyzing the structure of small viral proteins like SIRV-1 protein 510?

For small proteins like SIRV-1 protein 510 (39 amino acids), NMR spectroscopy offers significant advantages over crystallography. Based on methodologies used for similar-sized proteins, 2D [¹⁵N, ¹H]-HSQC experiments with uniform sampling (collecting 1024 and 256 points in direct and indirect dimensions, respectively) would be appropriate for initial structural analysis . For more detailed structural determination, 3D experiments such as HNCA, HNCO, HN(CA)CO, HN(CO)CA, and CBCA(CO)NH should be conducted using 50% non-uniform sampling techniques . These experiments, performed at approximately 298K on equipment such as a 600 MHz spectrometer equipped with a CP-QCI-F z-gradient probe, would enable complete backbone assignment and secondary structure determination.

How can differential scanning fluorimetry (DSF) be utilized to assess thermal stability and metal binding properties of viral proteins?

DSF has proven valuable for assessing the thermal stability of viral proteins and identifying potential metal cofactors. In studies of other viral proteins, DSF was used to screen 17 different metals to identify those that enhanced protein stability . For example, zinc was found to increase thermal stability by 3.0°C in one viral protein, indicating specific metal binding properties . For SIRV-1 protein 510, researchers should:

• Prepare protein samples at 1-10 μM concentration in appropriate buffer

• Add fluorescent dye (typically SYPRO Orange)

• Test various metal ions (Zn²⁺, Fe²⁺, Ni²⁺, etc.) at 0.1-1 mM concentrations

• Monitor fluorescence during temperature ramping (25-95°C)

• Analyze melting temperature (Tm) shifts to identify stabilizing metal cofactors

This approach can reveal important functional and structural characteristics of the protein that might not be apparent from sequence analysis alone.

What experimental approaches can reveal the function of SIRV-1 protein 510 in viral replication and host interaction?

To determine the function of SIRV-1 protein 510, researchers should employ a multi-faceted approach based on methodologies used for related archaeal viral proteins:

• Expression studies in host systems: Using inducible expression systems in Sulfolobus species to observe phenotypic effects. Studies with related viral proteins demonstrated that expression of certain viral proteins resulted in cell enlargement and inhibition of cell division .

• Flow cytometry analysis: To quantify changes in cell size and DNA content following protein expression. This approach revealed that expression of certain viral proteins resulted in cells with diameters increased by 3-6 times and containing over 6 genome equivalents .

• Transcriptome analysis: To identify host genes differentially expressed in response to viral protein expression. Principal component analysis of RNA-seq data can distinguish control cultures from protein-expressing cultures, as demonstrated with other viral proteins .

• Conservation analysis: To identify potential conserved targets across Sulfolobales. This approach identified 103 differentially expressed genes in one study .

This comprehensive approach would provide insights into both the molecular function of protein 510 and its effects on host physiology.

How might comparative analysis with related viral proteins inform the functional characterization of SIRV-1 protein 510?

The functional characterization of SIRV-1 protein 510 can be significantly advanced through comparative analysis with related proteins from archaeal viruses. Studies of the SiL_0190 clade of proteins demonstrated that viral homologs from different families (including lipothrixviruses and turriviruses) exhibited similar functional properties when expressed in host cells .

A systematic approach should include:

• Phylogenetic analysis to identify close homologs in other archaeal viruses

• Expression of multiple homologs under identical conditions

• Comparative phenotypic analysis (cell morphology, DNA content)

• Quantitative assessment of phenotypic effects (percentage of cells showing enlargement, degree of enlargement)

Data from such studies with related proteins showed that 57.7% and 43.4% of cells expressing certain viral proteins increased their diameter by 4-fold and 3-fold respectively at 24 hours post-induction . Similar quantitative assessments for SIRV-1 protein 510 would enable precise functional comparisons.

What techniques are recommended for investigating potential nucleic acid binding properties of SIRV-1 protein 510?

Given that many small viral proteins interact with nucleic acids, and considering related archaeal viral proteins contain RHH (Ribbon-Helix-Helix) domains associated with DNA binding , investigating the nucleic acid binding properties of SIRV-1 protein 510 is essential. Recommended techniques include:

• Electrophoretic Mobility Shift Assays (EMSA): Using radiolabeled or fluorescently-labeled DNA/RNA fragments to detect binding interactions

• Isothermal Titration Calorimetry (ITC): For quantitative determination of binding affinities and thermodynamic parameters

• Microscale Thermophoresis (MST): A solution-based technique for measuring interactions with minimal sample consumption

• Chromatin Immunoprecipitation (ChIP) or CLIP (Cross-Linking Immunoprecipitation): For identifying binding targets in vivo

These techniques should be applied with both random and viral genomic sequences to determine if the protein exhibits sequence-specific binding behavior.

What quality control measures should be implemented when working with recombinant SIRV-1 protein 510?

Comprehensive quality control is essential when working with recombinant SIRV-1 protein 510. Based on methodologies used for similar viral proteins, the following measures are recommended:

• Purity assessment: SDS-PAGE analysis with densitometry (aim for >95% purity)

• Mass spectrometry verification: Confirm molecular weight under denaturing conditions. For example, mass spectrometry under denaturing conditions was used to verify the molecular weight of a purified viral protein at 27136.33 Da, matching the expected value for the monomeric form .

• Folding verification: 1D NMR analysis can confirm that the protein is properly folded, as demonstrated with other recombinant viral proteins .

• Thermal stability testing: Differential scanning fluorimetry to assess batch-to-batch consistency

• Functional assays: Activity tests specific to predicted protein function (DNA binding, protein-protein interactions, etc.)

• Oligomerization assessment: Size exclusion chromatography to determine whether the protein exists as a monomer or forms oligomers. In studies of related proteins, this technique revealed unexpected oligomerization states .

Implementing these quality control measures ensures experimental reproducibility and reliable results.

What strategies can overcome expression and purification challenges for small archaeal viral proteins?

Small viral proteins like SIRV-1 protein 510 often present unique challenges during expression and purification. Based on successful strategies with similar proteins, researchers should consider:

• Fusion partners: MBP fusion has demonstrated high success rates, yielding approximately 120 mg of soluble protein per liter of culture for other archaeal viral proteins .

• Expression temperature optimization: Lower temperatures (16-18°C) often improve folding and solubility

• Codon optimization: Adapting codons for the expression host can significantly improve yields

• Solubility screening: Testing multiple buffer conditions during purification

• Protease inhibitor selection: Tailored to the specific expression system

• On-column refolding: For proteins prone to aggregation or misfolding

• Detergent screening: If the protein has hydrophobic regions that might cause aggregation

These approaches have proven effective for challenging viral proteins and would likely benefit the expression and purification of SIRV-1 protein 510.

How can researchers assess the impact of metal cofactors on the structure and function of SIRV-1 protein 510?

Metal cofactors can significantly influence viral protein structure and function. A systematic approach to investigating potential metal cofactor interactions includes:

• Metal-depletion studies: Using EDTA soaking to observe structural changes. In studies of other viral proteins, EDTA soaking led to crystal cracking and loss of electron density in metal-binding regions .

• Differential scanning fluorimetry: To identify stabilizing metals. Testing multiple metals (e.g., 17 different metals in one study) can reveal specific stabilizing interactions, as demonstrated by the 3.0°C increase in thermal stability observed with zinc for another viral protein .

• Mutagenesis of potential coordination sites: Individual and combined mutations of predicted metal-binding residues, followed by stability assessments. Studies with other viral proteins showed approximately 2°C reduction in thermal stability for each single mutation and 6°C for triple mutants .

• Chemical shift perturbation analysis: Using NMR to map residues affected by metal binding

• Metal quantification: Using techniques like 5F-BAPTA and 19F NMR to identify and quantify bound metals, as demonstrated for iron detection in other viral proteins .

This comprehensive approach enables detailed characterization of metal cofactor interactions and their functional implications.

How might SIRV-1 protein 510 relate to host cell division inhibition mechanisms observed with other archaeal viral proteins?

Studies with related archaeal viral proteins have revealed intriguing effects on host cell division. Expression of certain viral proteins resulted in enlarged cells containing multiple genome equivalents, suggesting inhibition of cell division but not DNA replication . This phenotype has been observed with various viral proteins across different families of Sulfolobales viruses .

For SIRV-1 protein 510, researchers should investigate:

• Whether expression causes similar cell enlargement phenotypes (63.8 ± 5.2% of cells showed increased size in studies with related proteins)

• Quantitative assessment of cell diameter increases (up to 6-fold increases observed with other proteins)

• DNA content analysis in enlarged cells (over 6 genome equivalents observed in some cases)

• Temporal dynamics of the phenotype (strongest effects at 24 hours post-induction for some proteins, with decreasing effects during prolonged incubation)

• Comparative analysis with other viral proteins that cause similar phenotypes

This research direction could reveal conserved mechanisms of archaeal virus-host interaction and potentially identify new targets for antiviral strategies.

What structural biology approaches would be most informative for determining the molecular mechanism of SIRV-1 protein 510?

Given the limited structural information currently available for SIRV-1 protein 510, a multi-technique structural biology approach would be most informative:

• X-ray crystallography: Despite challenges with small proteins, crystallography remains valuable if crystals can be obtained. For related proteins, screening 864 conditions at different temperatures proved successful .

• NMR spectroscopy: Particularly suitable for small proteins like SIRV-1 protein 510 (39 amino acids). 2D and 3D experiments as outlined in Section 2.2 would provide detailed structural information.

• Cryo-EM: If the protein forms larger complexes with host proteins or nucleic acids

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify flexible regions and binding interfaces

• Small-angle X-ray scattering (SAXS): For solution structure determination

• Computational structure prediction: Using AlphaFold2 or similar tools, validated experimentally

Integration of these approaches would provide complementary structural insights, overcoming limitations of any single method.

How can transcriptomic and proteomic approaches reveal the impact of SIRV-1 protein 510 on host cellular processes?

Comprehensive '-omics' approaches can provide critical insights into the functional impact of SIRV-1 protein 510 on host cells. Based on successful studies with related proteins, the following methodological approach is recommended:

• RNA-seq analysis: Compare control cultures vs. protein-expressing cultures at multiple time points. In studies with related proteins, this approach identified 269 and 155 differentially expressed genes before and after induction, respectively .

• Principal component analysis: To visualize major transcriptional changes. This technique effectively distinguished control cultures from protein-expressing cultures in previous studies .

• Conservation filtering: To identify core affected pathways. This approach reduced 269 differentially expressed genes to 103 high-confidence targets in one study .

• Proteomics: To identify changes in protein abundance and post-translational modifications

• ChIP-seq: If the protein is suspected to interact with DNA, to identify binding sites genome-wide

• Integration of multiple datasets: To build comprehensive models of affected cellular pathways

This integrated approach would provide a systems-level understanding of how SIRV-1 protein 510 impacts host cellular processes, potentially revealing its role in viral replication and host manipulation.