Recombinant Sulfolobus islandicus rod-shaped virus 1 Uncharacterized protein 98 (98)

What is Sulfolobus islandicus rod-shaped virus 1 Uncharacterized protein 98 (P98)?

Sulfolobus islandicus rod-shaped virus 1 (SIRV-1) Uncharacterized protein 98 (P98) is a viral protein consisting of 98 amino acids encoded by ORF 98 . The protein has the UniProt accession number Q8QL14 and is also known as hypothetical protein SIRV1gp42 . Its amino acid sequence is:

MAITLLEGALYGFFAVTGVLIASFIIGEIVHLYNEKQSNENFAKAIDQMSKSTVTAIESI KDTTVTGINALLNMDTLRDVNSLAREKAKDQNPSSQAK

The protein appears to contain hydrophobic regions consistent with transmembrane domains, as indicated by the amino acid composition with stretches of hydrophobic residues (LLEGALYGFFAVTGVLIASFII) that are characteristic of membrane-embedded proteins. Despite being labeled as "uncharacterized," functional studies have revealed its critical role in the viral life cycle, particularly in viral-mediated host cell lysis.

What is the structural and functional significance of SIRV1 P98?

SIRV1 P98 functions as a key component in the unique archaeal viral lysis system. Research indicates that P98 is functionally homologous to STIV (Sulfolobus turreted icosahedral virus) protein C92, despite these viruses having fundamentally different morphotypes and genome sequences . The most significant functional characteristic of P98 is its ability to independently form pyramid-like structures on the cell surface of Sulfolobus hosts, which precede virus-induced cell lysis .

Structurally, P98 contains distinct domains with specific functions:

• N-terminal domain (42% identity with STIV C92): Likely contains a transmembrane region that anchors the protein to the host cell membrane

• C-terminal domain (67% identity with STIV C92): Potentially involved in protein-protein interactions and formation of the pyramid lysis structures

This domain architecture enables the construction of chimeric proteins between P98 and C92 that retain functional activity, suggesting conserved structural elements important for viral lysis mechanisms in archaeal systems .

How do you express and purify recombinant SIRV1 P98 for experimental studies?

Expression and purification of recombinant SIRV1 P98 typically employs bacterial expression systems, most commonly E. coli, as indicated by product information from commercial sources . For researchers planning to produce this protein, the following methodological approach is recommended:

• Cloning strategy:

  • Design primers with appropriate restriction sites (e.g., AgeI as used in chimeric construct designs)

  • Clone the full P98 coding sequence into an expression vector containing a suitable affinity tag

  • Consider codon optimization for E. coli if expression levels are suboptimal

• Expression conditions:

  • Transform into an E. coli strain optimized for recombinant protein expression (BL21(DE3) or derivatives)

  • Grow cultures at lower temperatures (16-25°C) after induction to enhance protein solubility

  • Test multiple induction conditions (IPTG concentration, duration) to optimize yield

• Purification protocol:

  • Utilize affinity chromatography based on the incorporated tag

  • Follow with size exclusion chromatography to ensure purity

  • Store in Tris-based buffer with 50% glycerol at -20°C for stability, as recommended for commercial preparations

For membrane-associated proteins like P98, inclusion of detergents during purification may be necessary to maintain proper folding and function.

How can chimeric constructs of SIRV1 P98 and STIV C92 be designed for functional studies?

Creating chimeric constructs between SIRV1 P98 and STIV C92 provides valuable insights into domain functionality and homology. Based on the described research methodology, the following approach has proven effective:

• Design and PCR amplification:

  • Engineer restriction sites (e.g., AgeI) at protein termini

  • Introduce a BsrGI restriction site after the predicted N-terminal transmembrane domain of each protein

  • Amplify individual domains using specific primers (e.g., C92-AgeI-F, C92-BsrGI-R for C92 N-terminus; P98-BsrGI-F, P98-AgeI-R for P98 C-terminus)

• Domain fusion:

  • Digest amplicons with BsrGI

  • Ligate N-terminal domain from one protein to C-terminal domain of the other

  • Verify fusions by restriction digestion and DNA sequencing

• Functional evaluation:

  • Express chimeric constructs in Sulfolobus hosts

  • Assess pyramid formation through electron microscopy

  • Evaluate lysis efficiency in comparison to wild-type proteins

  • Test chimeric proteins both in isolation and in viral infection context

This methodology has successfully demonstrated that N-terminal C92 fused with C-terminal P98 (and vice versa) retain functional capability to form pyramid structures, confirming functional homology despite sequence divergence .

What techniques are most effective for studying the membrane topology of SIRV1 P98?

Understanding the membrane topology of P98 is crucial for elucidating its role in viral lysis. Based on research methodologies employed for similar proteins, these techniques would be most effective:

• Computational prediction:

  • Apply transmembrane prediction algorithms (TMHMM, TMPred) to identify potential membrane-spanning regions

  • Use hydropathy plots to confirm the presence of hydrophobic domains

• Experimental validation:

  • Protease protection assays: Express P98 in membrane systems and treat with proteases; protected fragments indicate membrane-embedded regions

  • Cysteine accessibility methods: Introduce cysteine residues at strategic positions and assess their accessibility to membrane-impermeable modifying reagents

  • Fluorescence-based approaches: Create GFP fusion proteins at N- and C-termini to determine their cellular localization relative to membranes

• Structural characterization:

  • Detergent solubilization trials to identify optimal conditions for extraction

  • Cryo-electron microscopy of P98 integrated into lipid environments

  • NMR spectroscopy of isotopically labeled protein domains

These approaches would help map the precise orientation of P98 in membranes and identify which domains are exposed to the cytoplasm versus the extracellular environment, providing insight into the mechanism of pyramid formation.

How does SIRV1 P98 contribute to the unique archaeal viral lysis mechanism?

The archaeal viral lysis mechanism facilitated by P98 represents a fundamentally different pathway compared to bacteriophage or eukaryotic viral lysis systems. Research findings reveal several key aspects of this process:

• Independent pyramid formation:

  • P98 alone is sufficient to induce pyramid-like lysis structures on archaeal cell surfaces when expressed in Sulfolobus hosts

  • This suggests P98 functions as the primary architectural protein in the lysis machinery

• Conserved lysis mechanism:

  • Despite SIRV1 and STIV having different morphologies and genome sequences, they share this pyramidal lysis system

  • The functional homology between P98 and C92 indicates evolutionary conservation of this lysis mechanism among diverse archaeal viruses

• Structural transformation process:

  • The pyramid structures likely form through progressive rearrangement of host cell membrane

  • The transmembrane domain of P98 anchors the protein while its C-terminal domain may facilitate protein-protein interactions to assemble the pyramidal structures

• Cell lysis completion:

  • The pyramids eventually open at their apex to release viral progeny

  • This process likely involves localized membrane disruption rather than complete cell wall degradation as in bacteriophage lysis

This mechanism represents a unique adaptation to the extreme environments inhabited by Sulfolobus species, which lack a peptidoglycan cell wall but possess a crystalline S-layer and unique membrane composition.

What are the key considerations for designing mutational studies of SIRV1 P98?

Designing effective mutational studies for P98 requires careful consideration of its functional domains and potential mechanistic roles. Based on established protein research methodologies, the following approach is recommended:

• Target selection:

  Domain	Target Regions	Mutation Strategy
  N-terminal (aa 1-40)	Transmembrane region	Conservative substitutions to preserve hydrophobicity while altering specific residues
  Mid-region (aa 41-70)	Potential interaction site	Alanine scanning to identify essential residues
  C-terminal (aa 71-98)	Likely functional domain	Deletion analysis and point mutations at conserved residues

• Mutation types to consider:

  • Single amino acid substitutions at highly conserved positions

  • Domain swapping between P98 and C92 at finer resolution than previous chimeric studies

  • Truncation mutants to identify minimal functional domains

  • Insertion of reporter tags at permissive sites to track localization

• Functional assays:

  • Pyramid formation assessment through electron microscopy

  • Quantitative measurement of lysis efficiency

  • Interaction studies with host cell proteins

  • Comparative analysis with wild-type P98 in both isolated expression and viral infection contexts

• Controls and validation:

  • Include C92 mutational analysis in parallel for comparative insights

  • Verify protein expression levels to ensure phenotypic differences aren't due to expression variation

  • Confirm protein folding integrity through biophysical methods before attributing functional changes to specific mutations

This structured approach would help delineate the specific amino acid requirements for P98 function and identify key structural elements involved in the archaeal viral lysis mechanism.

How can structural analysis of SIRV1 P98 inform antiviral strategies against archaeal viruses?

Although archaeal viruses like SIRV1 aren't pathogenic to humans, understanding their lysis mechanisms has broader implications for antiviral research. Structural analysis of P98 can inform several aspects of potential antiviral approaches:

• Structural determination priorities:

  • High-resolution structure of full-length P98 in membrane context

  • Identification of protein-protein interaction interfaces

  • Mapping of dynamic conformational changes during pyramid formation

• Transferable insights to other viral systems:

  • Novel membrane remodeling mechanisms potentially shared with other viruses

  • Unique protein architectural elements that could represent conserved viral strategies

  • Structure-function relationships of minimal lysis systems

• Potential intervention targets:

  • Inhibition of P98 oligomerization to prevent pyramid formation

  • Targeting of the interface between N- and C-terminal domains to disrupt function

  • Prevention of membrane insertion as an early intervention

• Application to extremophile biotechnology:

  • Engineering controlled lysis systems for extremophilic industrial applications

  • Development of archaeal expression systems with regulatable lysis proteins

  • Adaptation of archaeal viral elements for extreme environment biotechnology

The understanding of P98 structure could also provide insights into fundamental membrane biology and protein-lipid interactions in extreme environments, with potential applications beyond virology in fields such as membrane protein engineering and synthetic biology.

What approaches can be used to study P98 interactions with host cell components?

Understanding P98 interactions with host cellular components is essential for fully elucidating its lysis mechanism. The following methodologies are particularly suitable for archaeal systems:

• Protein-protein interaction methods:

  • Co-immunoprecipitation: Using tagged versions of P98 to pull down interacting partners

  • Proximity labeling: Employing BioID or APEX2 fusions to identify proteins in close proximity to P98 in vivo

  • Yeast two-hybrid adapted for archaeal proteins: Modified to account for extremophilic protein properties

• Membrane interaction studies:

  • Lipid binding assays: Using liposomes composed of archaeal lipids to assess membrane affinity

  • Fluorescence resonance energy transfer (FRET): To measure dynamic interactions with membrane components

  • Atomic force microscopy: To visualize P98-induced membrane deformations at nanoscale resolution

• In situ localization:

  • Immunogold electron microscopy: To precisely localize P98 during different stages of pyramid formation

  • Super-resolution microscopy: Adapted for archaeal cells to track P98 dynamics

  • Correlative light and electron microscopy: To connect protein behavior with ultrastructural changes

These techniques, adapted for the unique challenges of archaeal systems (high temperature, acidic pH), would provide crucial insights into how P98 orchestrates the remarkable structural transformations leading to pyramidal lysis structures.

How can researchers distinguish between the functions of SIRV1 P98 and STIV C92 in experimental settings?

Distinguishing the specific functions of these homologous proteins requires carefully designed experimental approaches:

• Comparative expression studies:

  • Express each protein individually in the same Sulfolobus strain under identical conditions

  • Quantitatively compare pyramid formation efficiency, morphology, and lysis kinetics

  • Analyze gene expression changes in host cells in response to each protein

• Cross-complementation assays:

  • Create knockout viruses lacking their native lysis protein

  • Complement with the homologous protein from the other virus

  • Assess restoration of function and identify any functional deficiencies

• Domain-specific analysis:

  • Generate more refined chimeric proteins with smaller domain swaps

  • Map functional differences to specific protein regions

  • Correlate with structural differences in the two proteins

• Host-specific interactions:

  • Compare protein-protein interaction networks for each protein

  • Identify unique binding partners that might explain functional differences

  • Analyze host response signatures specific to each protein

Through these approaches, researchers can differentiate between shared core functions and virus-specific adaptations, providing insight into the evolution of archaeal viral lysis mechanisms.