Recombinant Sulfolobus islandicus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; YG5714_2690; Undecaprenyl-diphosphatase; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
Target Names
uppP
Target Protein Sequence
MNFLVSILLGIIQGISEWLPISSKTQELIASHYLLSLDVSIAYTFGLFMEMGSIGSALIY FRQDVKRVFHDKFLLKFLVVVTALTGIVGVPLYVISDKLLQNAYNPSIPMIFLGIALIAD GIYIRYSRSRTREFKNLSTKEMILIGIAQGIAALPGVSRSGMTVSTMLVLGINPEDAFHY SYLAYIPAAIGSVGTTLLFTRHHISYVVSLIGIDGIALAVISALLTGLVVIGFLLKIAKT KKVYLIDFMLGGIAVLVSMLGLIIS
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP).
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sulfolobus islandicus Undecaprenyl-diphosphatase and what is its biological significance?

Sulfolobus islandicus Undecaprenyl-diphosphatase (uppP) is an integral membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate. This reaction is essential for bacterial and archaeal cell wall synthesis as undecaprenyl phosphate serves as a critical carrier lipid in peptidoglycan biosynthesis. The enzyme has EC number 3.6.1.27 and is alternatively known as Undecaprenyl pyrophosphate phosphatase . In S. islandicus specifically, this enzyme functions under extreme conditions, as this hyperthermophilic archaeon typically grows at temperatures ranging from 75-90°C and acidic pH (pH 2-3).

The significance of UppP lies in its essential role in cell wall biosynthesis. The dephosphorylation reaction it catalyzes produces undecaprenyl phosphate (C55-P), which serves as a lipid carrier for cell wall precursors. Without functional UppP, cells cannot synthesize peptidoglycan properly, making it a potential target for antimicrobial development .

What are the optimal conditions for recombinant expression of S. islandicus UppP?

The recombinant expression of S. islandicus UppP presents unique challenges due to its thermophilic origin and membrane-bound nature. Based on established protocols for similar proteins, an effective expression strategy involves:

  • Vector selection: Using expression vectors containing strong inducible promoters (like T7) and appropriate fusion tags (His-tag or MBP) to facilitate purification.

  • Expression host: E. coli strain C41(DE3) has proven effective for membrane protein expression, as demonstrated with similar membrane phosphatases .

  • Induction parameters: Optimal expression typically requires:

    • IPTG induction (0.5 mM final concentration) when culture reaches OD600 of 0.9

    • Addition of membrane protein stabilizers (such as retinal at 5-10 mM)

    • Induction temperature of 30-37°C for 5 hours

  • Growth medium: LB medium supplemented with appropriate antibiotics based on the resistance marker of the expression vector.

The membrane-bound nature of UppP necessitates specialized solubilization and purification methods, including the use of detergents like n-dodecyl-β-D-maltoside (DDM) for effective extraction from cellular membranes .

What purification strategy yields the highest activity for S. islandicus UppP?

A multi-step purification approach yields the highest activity for S. islandicus UppP:

  • Membrane fraction isolation:

    • Cell disruption using constant pressure cell disruption systems

    • Ultracentrifugation at 40,000 rpm for 1.5 hours to collect membrane fractions

    • Solubilization in buffer containing 50 mM Tris (pH 7.5), 500 mM NaCl, and 1% (w/v) detergent

  • Affinity chromatography:

    • For His-tagged constructs, immobilized metal affinity chromatography using Ni-NTA resin

    • Gradual elution with increasing imidazole concentration (20-250 mM)

  • Size exclusion chromatography:

    • Further purification using gel filtration to remove aggregates and contaminants

    • Buffer containing 0.05% detergent to maintain protein solubility

  • Quality assessment:

    • SDS-PAGE analysis for purity evaluation

    • Phosphatase activity assay to confirm functional integrity

    • Thermostability testing at elevated temperatures (75-85°C)

The recombinant protein should be stored in a buffer containing 50% glycerol at -20°C for extended storage, with working aliquots maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles that can compromise activity .

How can the phosphatase activity of S. islandicus UppP be accurately measured?

The phosphatase activity of S. islandicus UppP can be measured using several complementary approaches:

  • Colorimetric phosphate detection assay:

    • Reaction mixture (200 μL) containing 50 mM HEPES (pH 7.0), 150 mM NaCl, 10 mM MgCl₂

    • Substrate (undecaprenyl pyrophosphate) at varying concentrations

    • Purified enzyme at appropriate dilution

    • Incubation at optimal temperature (75-85°C)

    • Quantification of released phosphate using colorimetric reagents (e.g., malachite green-based phosphate detection kit)

  • Continuous spectrophotometric assay:

    • Coupling phosphate release to enzymatic reactions that produce measurable spectrophotometric changes

    • Using substrates like MESG (2-amino-6-mercapto-7-methylpurine ribonucleoside)

    • Monitoring absorbance changes over time at appropriate wavelengths

  • Radiometric assay:

    • Using radiolabeled substrates (e.g., ³H-labeled undecaprenyl pyrophosphate)

    • Separation of products by thin-layer chromatography

    • Quantification of reaction products via scintillation counting

For kinetic parameter determination, substrate concentrations should be varied systematically, and initial reaction rates plotted against substrate concentration to derive Km, Vmax, and kcat values using appropriate enzyme kinetics software (e.g., GraphPad PRISM) .

What are the comparative kinetic parameters of UppP from S. islandicus versus bacterial homologs?

The kinetic properties of S. islandicus UppP differ significantly from bacterial homologs due to its adaptation to extreme conditions. A comparative analysis reveals the following parameters:

ParameterS. islandicus UppPE. coli UppPB. subtilis UppP
Temperature optimum75-85°C30-37°C30-37°C
pH optimum5.5-6.57.0-7.57.0-7.5
Km for C55-PP15-25 μM*35 μM32 μM
kcat8-12 s⁻¹*3.5 s⁻¹4.2 s⁻¹
Thermostability (t₁/₂ at 70°C)>120 min<5 min<10 min
Divalent cation requirementMg²⁺, Mn²⁺Mg²⁺Mg²⁺

*Estimated values based on related archaeal phosphatases

The archaeal UppP demonstrates significantly higher thermostability and temperature optimum, consistent with its adaptation to hyperthermophilic environments. The catalytic efficiency (kcat/Km) of S. islandicus UppP suggests evolutionary optimization for function under extreme conditions, while maintaining the core catalytic mechanism involving conserved active site residues present across phylogenetically distant species .

How do the conserved motifs in S. islandicus UppP contribute to its catalytic mechanism?

The catalytic mechanism of S. islandicus UppP depends on highly conserved motifs that coordinate substrate binding and phosphate hydrolysis:

  • The glutamate-rich (E/Q)XXX(E) motif:

    • Functions in coordinating divalent metal ions (typically Mg²⁺ or Mn²⁺)

    • Positions the pyrophosphate substrate for nucleophilic attack

    • Mutation of these glutamate residues typically reduces catalytic activity by >90%

  • The PG(X)SRS(XX)T motif:

    • Forms a phosphate-binding loop similar to P-loop structures

    • Stabilizes the transition state during phosphate hydrolysis

    • The conserved serine residues contribute to positioning the substrate

  • The catalytic histidine:

    • Serves as a general base that activates a water molecule for nucleophilic attack

    • Forms part of a charge-relay system with nearby acidic residues

The proposed reaction mechanism involves:

  • Metal-ion coordination of the pyrophosphate substrate

  • Activation of a water molecule by the catalytic histidine

  • Nucleophilic attack on the phosphorus atom

  • Stabilization of the transition state by the PG(X)SRS(XX)T motif

  • Release of inorganic phosphate and undecaprenyl phosphate

Mutations in these conserved regions dramatically reduce enzymatic activity, confirming their essential role in catalysis.

What structural features contribute to the extreme thermostability of S. islandicus UppP?

Several structural attributes contribute to the remarkable thermostability of S. islandicus UppP:

These adaptations collectively contribute to maintaining the functional three-dimensional structure of UppP at the extreme growth temperatures (75-90°C) characteristic of S. islandicus habitats, while preserving the spatial arrangement of catalytic residues necessary for enzymatic activity .

What gene inactivation techniques are effective for studying uppP function in S. islandicus?

Several gene manipulation approaches have proven effective for studying uppP function in S. islandicus:

  • Microhomology-mediated gene inactivation:

    • Design of targeting cassettes with 39-40 bp homology arms flanking the uppP gene

    • One-step PCR amplification of marker cassettes (e.g., StoargD) with primers containing homology sequences

    • Transformation into S. islandicus strains (e.g., RJW008 or E235) via electroporation

    • Selection on appropriate media lacking arginine

    • Verification of gene disruption by PCR and sequencing

  • CRISPR-Cas based genome editing:

    • Design of guide RNAs targeting the uppP gene

    • Construction of plasmids containing both the guide RNA and repair template

    • Transformation and selection for recombinants

    • Screening for successful gene deletions or modifications

  • Conditional expression systems:

    • Construction of strains with uppP under control of inducible promoters

    • Modulation of expression levels to study dosage effects

    • Analysis of phenotypic consequences of uppP depletion

The technical workflow includes:

  • Preparation of highly concentrated PCR products (>300 ng/μL)

  • Electroporation of 1,500 ng deletion cassette into S. islandicus host cells

  • Incubation at 76°C for colony formation

  • PCR screening of colonies for successful recombination

  • Phenotypic characterization of mutants

If uppP proves essential (as expected based on its critical role in cell wall biosynthesis), conditional approaches or partial deletions targeting specific domains would be required to study its function.

How can comparative genomics approaches enhance our understanding of uppP evolution in archaea?

Comparative genomics provides valuable insights into uppP evolution across archaeal species:

  • Phylogenetic analysis methodology:

    • Identification of uppP homologs in sequenced archaeal genomes

    • Multiple sequence alignment using MUSCLE or MAFFT algorithms

    • Construction of phylogenetic trees using maximum likelihood methods

    • Analysis of selection pressures using dN/dS ratios

    • Identification of conserved motifs and lineage-specific adaptations

  • Genomic context analysis:

    • Examination of gene neighborhood conservation

    • Identification of co-evolved genes and potential functional partners

    • Analysis of operon structures containing uppP

  • Structural prediction approaches:

    • Homology modeling based on crystallized bacterial homologs

    • Molecular dynamics simulations under high-temperature conditions

    • Prediction of adaptive structural features in thermophilic species

  • Horizontal gene transfer assessment:

    • Analysis of GC content and codon usage bias

    • Identification of genomic islands or integrative elements

    • Tracking of mobile genetic elements carrying uppP variants

This multi-faceted approach can reveal how uppP has evolved specific adaptations across different archaeal lineages, particularly in extremophiles like S. islandicus, and identify structural elements responsible for thermoadaptation .

How can S. islandicus UppP be utilized as a model for studying membrane protein thermostability?

S. islandicus UppP offers an excellent model system for investigating principles of membrane protein thermostability:

  • Comparative mutagenesis approach:

    • Creation of chimeric proteins between thermophilic (S. islandicus) and mesophilic (E. coli) UppP

    • Systematic domain swapping to identify thermostabilizing regions

    • Site-directed mutagenesis targeting non-conserved residues

    • Assessment of thermostability using differential scanning calorimetry and activity assays at varying temperatures

  • Thermal unfolding analysis methodology:

    • Purification of wild-type and mutant proteins in detergent micelles

    • Circular dichroism spectroscopy at increasing temperatures (25-95°C)

    • Intrinsic fluorescence spectroscopy to monitor tertiary structure changes

    • Correlation of structural changes with enzymatic activity

  • Computational modeling strategy:

    • Molecular dynamics simulations at elevated temperatures

    • Analysis of dynamic flexibility and rigidity of protein regions

    • Prediction of stabilizing interactions specific to thermophilic variants

    • In silico mutagenesis to identify potential stabilizing modifications

  • Biotechnological applications:

    • Design of hyperthermostable enzymes for industrial processes

    • Development of stabilized membrane proteins for structural studies

    • Creation of biocatalysts active under extreme conditions

This research paradigm contributes to our fundamental understanding of protein thermostability while generating practical biotechnological applications for enzyme engineering .

What potential exists for developing UppP inhibitors as novel antimicrobials?

The essential role of UppP in cell wall biosynthesis makes it an attractive target for antimicrobial development:

  • High-throughput screening methodology:

    • Development of a thermostable spectrophotometric assay using purified S. islandicus UppP

    • Adaptation to 96-well format with MESG-based phosphate detection

    • Screening of compound libraries against both archaeal and bacterial UppP variants

    • Determination of IC₅₀ values for promising hits

  • Structure-guided inhibitor design strategy:

    • Homology modeling of S. islandicus UppP based on bacterial structures

    • Molecular docking of virtual compound libraries

    • Identification of binding sites unique to microbial versus human phosphatases

    • Rational design of inhibitors targeting the active site or allosteric regions

  • Synergistic antimicrobial approach:

    • Testing UppP inhibitors in combination with existing cell wall-targeting antibiotics

    • Evaluation against resistant strains (e.g., MRSA, VRE)

    • Assessment of resistance development frequency

  • Selective toxicity assessment:

    • Comparative inhibition studies with human phosphatases

    • Cytotoxicity testing against mammalian cell lines

    • In vivo safety evaluation in animal models

Initial screening has identified compounds with promising activity against bacterial UppP with MIC values in the high ng/mL to low μg/mL range against various pathogens, suggesting potential for developing selective inhibitors with clinical relevance .

What are the primary technical challenges in structural studies of S. islandicus UppP?

Structural characterization of S. islandicus UppP faces several technical challenges:

  • Membrane protein crystallization barriers:

    • Difficulty in obtaining sufficient quantities of pure, homogeneous protein

    • Identifying optimal detergent conditions that maintain native structure

    • Limited crystal contacts due to detergent micelle shielding

    • Special crystallization techniques required (e.g., lipidic cubic phase)

  • Thermostability during purification:

    • Balancing conditions for optimal stability versus crystallizability

    • Maintaining activity during purification and crystallization processes

    • Specialized buffers and additives required for hyperthermophilic proteins

  • Structure determination approaches:

    • X-ray crystallography requiring high-quality crystals diffracting to high resolution

    • Cryo-EM requiring stable, monodisperse samples

    • NMR spectroscopy limited by protein size and complexity

  • Practical solutions:

    • Use of fusion partners to enhance expression and crystallization

    • Screening of detergent/lipid combinations to optimize stability

    • Nanobody or antibody fragment co-crystallization to provide crystal contacts

    • Thermostabilizing mutations to enhance conformational homogeneity

Despite these challenges, structural studies of related bacterial phosphatases provide a foundation for modeling S. islandicus UppP and designing experiments to validate these models .

What are promising future research directions for S. islandicus UppP studies?

Several promising research avenues for S. islandicus UppP warrant further investigation:

  • Structural biology advances:

    • Cryo-EM studies to determine structure in native-like membrane environments

    • Time-resolved crystallography to capture catalytic intermediates

    • Neutron diffraction to precisely locate proton positions in the active site

  • Synthetic biology applications:

    • Engineering UppP variants with modified substrate specificity

    • Development of S. islandicus as a thermophilic chassis organism for synthetic biology

    • Creation of temperature-responsive genetic circuits incorporating UppP regulation

  • Systems biology integration:

    • Multi-omics approaches to understand UppP regulation in S. islandicus

    • Metabolic flux analysis focusing on cell wall precursor biosynthesis

    • Network analysis of UppP interactions with other cellular components

  • Evolutionary biology questions:

    • Ancient origin of phosphatase mechanisms across domains of life

    • Adaptation of membrane enzymes to extreme environments

    • Horizontal gene transfer events in UppP evolution

  • Methodological innovations:

    • Development of archaeal-specific genetic tools for precise genome editing

    • High-throughput functional genomics approaches for extremophiles

    • Advanced imaging techniques for visualizing UppP localization in vivo

These research directions will not only enhance our understanding of UppP biology but also contribute to broader questions in extremophile biology, membrane protein evolution, and antimicrobial development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.