Recombinant Sulfolobus islandicus UPF0290 protein LS215_1460 (LS215_1460)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

The LS215_1460 protein is produced recombinantly in heterologous expression systems. Key attributes include:

PropertyDetails
UniProt IDC3MQ04
Expression SystemsEscherichia coli (Product Code: CSB-EP502509FPB1-B) and Baculovirus (Product Code: CSB-BP502509FPB1)
Purity>85% (verified by SDS-PAGE)
Storage- Liquid: 6 months at -20°C/-80°C
- Lyophilized: 12 months at -20°C/-80°C
ReconstitutionDilute in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability
Tag InformationDetermined during manufacturing (exact tag unspecified)

Heterologous Expression

  1. Cloning: Gene insertion into the arabinose-inducible pSeSD vector.

  2. Transformation: Electroporation into S. islandicus.

  3. Induction: Arabinose-mediated protein expression.

  4. Purification: Nickel-affinity chromatography for His-tagged proteins .

Stability Considerations

Repeated freeze-thaw cycles degrade the protein. Working aliquots stored at 4°C retain functionality for up to one week .

Functional Insights

While LS215_1460’s biological role is uncharacterized, UPF0290 family proteins are hypothesized to participate in stress response or metabolic regulation in archaea. Notably:

  • Genetic Context: The carS gene (target name) is not linked to characterized operons in S. islandicus, suggesting a standalone function .

  • Conservation: Homologs of UPF0290 proteins are widespread in Sulfolobales, often co-occurring with viral RHH (ribbon-helix-helix) proteins that regulate cell division .

Biotechnological Relevance

  • Thermostability: Proteins from S. islandicus exhibit extreme thermal resilience, making LS215_1460 a candidate for industrial enzymes .

  • Tool Development: Studies on S. islandicus gene inactivation (e.g., CRISPR-based systems) enable precise manipulation of proteins like LS215_1460 for functional assays .

Challenges and Future Directions

  • Functional Characterization: No direct studies on LS215_1460’s enzymatic activity or interactions exist. Structural analysis (e.g., cryo-EM) is needed.

  • Optimization: Enhancing yield in Baculovirus systems and improving tag-specific purification protocols could broaden applications .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, kindly indicate them in your order notes and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for the specific delivery timeframe.
All of our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
carS; LS215_1460; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
Target Names
carS
Target Protein Sequence
MSIAYDLLLSILIYLPAFVANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALT FGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVL GASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction represents the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for recombinant production of LS215_1460?

Two primary expression approaches exist for LS215_1460, each with distinct advantages:

A. Heterologous Expression in E. coli:
While technically simpler, E. coli expression of thermophilic archaeal proteins often results in insoluble protein aggregates due to improper folding at mesophilic temperatures . When pursuing this approach:

  • Utilize specialized strains designed for membrane proteins

  • Express at lower temperatures (15-25°C) to improve folding

  • Consider fusion tags (MBP, SUMO) to enhance solubility

  • Verify proper folding through activity assays

B. Homologous Expression in Sulfolobus islandicus:
This approach yields properly folded, natively processed protein but requires specialized equipment for high-temperature cultivation . The arabinose-inducible expression system utilizing vectors pSeSD and pEXA represents the current gold standard for expression in S. islandicus . This system features:

  • P(araS-SD) promoter with engineered ribosome-binding site

  • Hexahistidine (6×His) tags for purification

  • Protease sites for tag removal

Comparative analysis of expression systems reveals:

ParameterE. coli ExpressionS. islandicus Expression
Protein foldingOften misfoldedNative conformation
Post-translational modificationsAbsentPreserved
Growth temperature15-37°C75-78°C (optimal)
YieldVariableHigh with optimized vectors
Technical complexityStandardRequires specialized equipment
Growth mediaStandard LBSpecialized (e.g., SCVy, ACVy)

When using S. islandicus expression, utilize strain E233S (ΔpyrEF ΔlacS) grown at 75-78°C in media containing arabinose for induction .

What purification protocols maximize yield and activity of LS215_1460?

For optimal purification of LS215_1460, implement the following protocol based on established methodologies:

  • Harvesting and Lysis:

    • Centrifuge cultures at 10,000 × g when OD600 reaches ~0.6

    • Resuspend in lysis buffer (50 mM phosphate-buffered saline, 500 mM NaCl, 20 mM imidazole)

    • Disrupt cells via sonication

    • Remove cellular debris by centrifugation (10,000 × g, 30 min, 4°C)

  • Affinity Chromatography:

    • Apply clarified lysate to Ni-nitrilotriacetic acid column

    • Wash extensively to remove non-specific binding

    • Elute with imidazole gradient (typically 250-500 mM)

    • Verify purity by SDS-PAGE (expect >85%)

  • Post-Purification Processing:

    • For increased purity, consider size exclusion chromatography

    • If required, remove His-tag using protease sites engineered into expression vectors

    • Concentrate protein using centrifugal concentrators with appropriate molecular weight cutoff

When expressing in S. islandicus, ensure your construct includes a properly positioned ribosome-binding site upstream of the start codon to guarantee proper translation initiation and His-tag incorporation .

What storage conditions optimize stability of purified LS215_1460?

As a thermophilic protein, LS215_1460 demonstrates enhanced stability compared to mesophilic counterparts but still requires optimized storage conditions:

  • Temperature Conditions:

    • Store at -20°C for routine use

    • For extended storage, maintain at -80°C

    • Working aliquots may be stored at 4°C for up to one week

  • Buffer Formulation:

    • Add glycerol to 5-50% final concentration before freezing (50% is recommended)

    • Aliquot to minimize freeze-thaw cycles

    • Avoid repeated freezing and thawing

  • Storage Forms:

    • Liquid form: 6-month shelf life at -20°C/-80°C

    • Lyophilized form: 12-month shelf life at -20°C/-80°C

  • Reconstitution Protocol (Lyophilized Protein):

    • Briefly centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration before storage

The thermostability of LS215_1460 makes it more resistant to denaturation than mesophilic proteins, but proper storage remains essential for maintaining structural integrity and function over extended periods.

What experimental approaches can elucidate the function of UPF0290 protein LS215_1460?

As an uncharacterized protein (UPF designation), LS215_1460 requires comprehensive experimental approaches for functional determination:

  • Genetic Manipulation Strategies:

    • CRISPR-based genome editing in S. islandicus

    • Unmarked gene deletion to assess loss-of-function phenotypes

    • Chromosomal integration at characterized sites using methods described for S. islandicus M.16.4

    • Conditional depletion if the gene proves essential, as suggested by transposon mutagenesis studies of similar proteins

  • Structural Analysis:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • Membrane topology mapping using accessibility studies

    • Computational structural prediction using AlphaFold

  • Interaction Studies:

    • Pull-down assays using His-tagged protein

    • Proximity labeling to identify neighboring proteins in situ

    • Co-immunoprecipitation coupled with mass spectrometry

    • If related to the RHH proteins described in Sulfolobales, perform DNA-binding assays

  • Physiological Characterization:

    • Phenotypic analysis of gene deletion mutants using electron microscopy

    • Growth assays under varying conditions (temperature, pH, carbon sources)

    • Metabolic profiling to identify affected pathways

  • Multi-omics Approaches:

    • Transcriptomics (RNA-seq) to identify differential gene expression in mutants

    • Proteomics to detect changes in protein levels or post-translational modifications

    • Metabolomics to observe metabolic shifts

The target name "carS" suggests possible involvement in carbon metabolism or regulation, while its transmembrane nature indicates potential roles in membrane integrity, transport, or signaling under extreme conditions.

How can integration site selection impact expression studies with LS215_1460?

When performing chromosomal integration studies with LS215_1460, the selection of integration sites significantly impacts expression levels and experimental outcomes. Recent research in S. islandicus M.16.4 has characterized 13 crRNAs targeting eight integration sites, revealing substantial position effects on gene expression .

Key findings regarding chromosomal position effects include:

  • Expression Level Variation:

    • Up to 1.49-fold difference in expression levels between integration sites

    • Plasmid-based expression is approximately twice as high as chromosomal expression, suggesting a plasmid copy number of ~2

  • Site Selection Criteria:

    • Distance from origins of replication (S. islandicus contains three origins: oriC1, oriC2, and oriC3)

    • ClsN enrichment values below 2

    • Preference for sites within 0.3 Mb from the nearest replication origin

  • Integration Methodology:

    • Utilize CRISPR-based integration systems

    • Construct mini-CRISPR arrays (repeat-spacer-repeat) with corresponding donor DNA

    • Include 500 bp homology arms flanking the integration cassette

These integration sites can be used for studying LS215_1460 function in its native context or for introducing modified versions for functional characterization, providing advantages over plasmid-based expression for long-term studies.

How can LS215_1460 contribute to understanding archaeal membrane adaptations to extreme environments?

As a transmembrane protein from a hyperthermophilic archaeon, LS215_1460 offers valuable insights into membrane adaptations to extreme conditions:

  • Membrane Architecture Studies:

    • Archaeal membranes contain unique ether-linked lipids rather than ester-linked lipids found in bacteria and eukaryotes

    • Analysis of LS215_1460's interaction with these lipids can reveal adaptation mechanisms

    • Integration of LS215_1460 into artificial membrane systems can assess its role in membrane stability at high temperatures

  • Comparative Genomics Approach:

    • Compare LS215_1460 sequence with homologs in other extremophiles and mesophiles

    • Identify conserved motifs specific to thermophilic archaea

    • Perform evolutionary analysis to trace adaptive changes

  • Structural Adaptations:

    • Identify features that contribute to thermostability (increased ionic interactions, hydrophobic packing)

    • Analyze membrane-spanning domains for thermophilic adaptations

    • Study protein dynamics at varying temperatures

  • Functional Context:

    • Determine whether LS215_1460 contributes to membrane integrity under temperature stress

    • Investigate potential roles in cell envelope maintenance

    • If related to the RHH proteins described in search result , it may function in gene regulation for environmental adaptation

Understanding LS215_1460 could provide insights into archaeal evolution and adaptation to extreme environments, potentially contributing to theories about the last archaeal-eukaryotic common ancestor (LAECA) .

What methodological innovations can improve research with thermophilic archaeal proteins like LS215_1460?

Advancing research with thermophilic archaeal proteins requires methodological innovations tailored to their unique properties:

  • Expression System Optimization:

    • Development of shuttle vectors with multiple selectable markers

    • Creation of stronger inducible promoters specific to hyperthermophiles

    • Engineering simplified purification strategies compatible with high-temperature growth

  • High-Throughput Screening:

    • Adaptation of reporter systems for thermophilic conditions

    • Development of thermostable fluorescent proteins for localization studies

    • Creation of archaeal two-hybrid systems for protein interaction screening

  • Cryo-EM Advances for Small Membrane Proteins:

    • Specialized grid preparation methods for membrane proteins

    • Novel detergents and nanodiscs optimized for archaeal membrane proteins

    • Computational approaches for reconstructing small membrane proteins

  • Genetic Tool Expansion:

    • Additional characterized integration sites across the genome

    • Inducible CRISPR interference systems for conditional knockdowns

    • Regulated protein degradation systems for temporal control

  • Specialized Functional Assays:

    • Development of high-temperature biochemical assays

    • In situ labeling and imaging techniques for thermophiles

    • Microfluidic systems for studying single-cell behaviors in thermophilic archaea

These methodological advances would facilitate more comprehensive characterization of proteins like LS215_1460, advancing our understanding of archaeal biology and extremophile adaptations.

How can researchers overcome solubility and folding challenges with recombinant LS215_1460?

Working with thermophilic membrane proteins presents unique challenges that require specialized approaches:

  • E. coli Expression Challenges:

    • Problem: Inclusion body formation and misfolding

    • Solution: Use specialized strains (C41/C43), lower induction temperatures (15-20°C), and specialized media formulations

    • Alternative: Consider cell-free expression systems with thermophilic components

  • Homologous Expression Challenges:

    • Problem: Low yield or inconsistent expression

    • Solution: Optimize induction timing and arabinose concentration; ensure proper ribosome binding site placement

    • Verification: Monitor expression through Western blotting or activity assays

  • Purification Challenges:

    • Problem: Co-purification of contaminating proteins

    • Solution: Implement two-step purification (affinity followed by size exclusion or ion exchange)

    • Quality Control: Verify purity through SDS-PAGE and mass spectrometry

  • Structural Integrity Assessment:

    • Problem: Difficulty confirming proper folding

    • Solution: Circular dichroism at elevated temperatures; thermal shift assays

    • Functional Verification: Develop activity assays based on predicted function

  • Membrane Protein Solubilization:

    • Problem: Poor extraction from membranes

    • Solution: Screen multiple detergents (DDM, LMNG, SMA copolymers)

    • Alternative Approach: Consider native nanodiscs or amphipols for stabilization

Researchers should also consider that S-layer proteins in Sulfolobus species (such as SlaA and SlaB) play crucial roles in cell envelope stability . If LS215_1460 interacts with these proteins, co-expression or co-purification approaches may be beneficial.

What controls are essential when designing experiments with LS215_1460?

Rigorous experimental design with appropriate controls is critical for reliable results with LS215_1460:

  • Expression Controls:

    • Non-induced samples to establish baseline expression

    • Empty vector controls to account for vector effects

    • Well-characterized reporter protein (e.g., LacS) as positive expression control

  • Genetic Manipulation Controls:

    • Parental strain without modifications

    • Integration of neutral marker at the same site when studying gene deletions

    • Complementation with wild-type gene to verify phenotype causation

  • Functional Assay Controls:

    • Heat-denatured LS215_1460 as negative control

    • Known proteins with similar predicted function as positive controls

    • Concentration gradients to establish dose-response relationships

  • Environmental Variable Controls:

    • Temperature stability tests (70-85°C range)

    • pH variation tests (pH 2-5 range typical for Sulfolobus)

    • Buffer composition controls

  • Technical Validation Controls:

    • Multiple independent protein preparations

    • Biological replicates (minimum n=3)

    • Technical replicates for each measurement

When designing experiments, follow systematic experimental design principles , clearly defining:

  • Independent variables (e.g., protein concentration, temperature)

  • Dependent variables (e.g., activity, binding affinity)

  • Confounding variables to control (e.g., buffer composition, pH)

  • Appropriate statistical analyses for data interpretation

Proper experimental design ensures reliable, reproducible results that advance our understanding of this fascinating thermophilic archaeal protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.