Recombinant Sulfolobus islandicus UPF0290 protein M1627_1414 (M1627_1414)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development according to your specifications.
Synonyms
carS; M1627_1414; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Sulfolobus islandicus (strain M.16.27)
Target Names
carS
Target Protein Sequence
MSIAYDLLLSILIYLPAFVANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALT FGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVL GASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction represents the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining protein stability?

For optimal stability of the recombinant Sulfolobus islandicus UPF0290 protein M1627_1414, long-term storage should be at -20°C or preferably -80°C in aliquots to avoid repeated freeze-thaw cycles, which can significantly degrade protein quality. The recommended storage buffer is a Tris/PBS-based buffer with 6% trehalose at pH 8.0. For working stocks, aliquots can be maintained at 4°C for up to one week.

For reconstitution, the lyophilized protein should be:

  • Briefly centrifuged prior to opening

  • Reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Supplemented with glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

This protocol minimizes protein degradation while maintaining functional integrity for experimental applications .

How can I verify the purity and integrity of the recombinant protein?

To verify the purity and integrity of recombinant Sulfolobus islandicus UPF0290 protein M1627_1414, employ a multi-step validation approach:

  • SDS-PAGE analysis: Commercial preparations typically have >90% purity as determined by SDS-PAGE. Run your protein alongside appropriate molecular weight markers to confirm the expected size of approximately 18-20 kDa (accounting for the His-tag).

  • Western blot analysis: Use anti-His antibodies to confirm the presence of the His-tagged protein.

  • Mass spectrometry: For comprehensive validation, peptide mass fingerprinting can verify the protein sequence.

  • Size exclusion chromatography: This can help determine if the protein exists in monomeric form or forms oligomers/aggregates.

  • Functional assays: Design biochemical assays based on the proposed CDP-archaeol synthase activity to verify functional integrity.

When interpreting results, consider that hyperthermophilic proteins like those from Sulfolobus species may display atypical migration patterns on SDS-PAGE due to their unique amino acid composition and thermal stability properties .

How does the UPF0290 protein function in relation to the S-layer architecture of Sulfolobus islandicus?

The relationship between UPF0290 protein M1627_1414 and the S-layer architecture of Sulfolobus islandicus represents an intriguing area of study. While direct evidence linking this specific UPF0290 protein to S-layer assembly is limited, we can infer potential associations based on what is known about Sulfolobus cell wall structure:

The S-layer in Sulfolobus species consists primarily of two glycosylated proteins:

  • SlaA (~120 kDa): Forms the crystalline surface layer with p3 symmetry

  • SlaB (~45 kDa): Acts as the membrane-anchoring stalk for SlaA

These proteins form a "stalk-and-cap" arrangement where SlaB anchors SlaA to the cytoplasmic membrane, creating the crystalline lattice that functions as the cell wall in these organisms .

Given that UPF0290 protein M1627_1414 (carS) is annotated as potentially involved in CDP-archaeol synthesis, it may play an indirect role in S-layer assembly by participating in the synthesis of membrane lipids that serve as anchoring points for S-layer proteins. Archaeal membranes contain unique lipids, and enzymes involved in their biosynthesis could be critical for proper S-layer attachment and organization.

To investigate this relationship experimentally, researchers could:

  • Perform co-immunoprecipitation studies to identify potential protein-protein interactions

  • Create gene deletion or knockdown strains to observe effects on S-layer formation

  • Use fluorescently tagged variants to visualize subcellular localization relative to the S-layer proteins

Such studies might reveal whether UPF0290 proteins like M1627_1414 participate in the complex molecular machinery supporting S-layer assembly and maintenance in extremophiles .

What experimental approaches can resolve the functional differences between UPF0290 protein M1627_1414 and related homologs like M1425_1364?

To investigate functional differences between UPF0290 protein M1627_1414 and its homolog M1425_1364, which shares identical amino acid sequence but differs in genomic context, a multifaceted experimental approach is required:

Experimental ApproachMethodologyExpected Outcome
Comparative genomic analysisAnalyze gene neighborhoods of M1627_1414 and M1425_1364Identify differences in operon structure and potential regulatory elements
Transcriptomic profilingRNA-seq under various conditionsDetermine if expression patterns differ despite identical protein sequences
Genetic complementationCreate deletion mutants with cross-complementationAssess functional interchangeability in vivo
Protein-protein interaction studiesPull-down assays, bacterial two-hybrid systemsIdentify potential different binding partners
Chromatin immunoprecipitationChIP-seq with tagged versions of both proteinsMap potential different DNA binding sites if they function as transcription factors

The key challenge is determining whether these proteins, despite identical sequences, might serve different functions due to differential expression, localization, or interaction partners. Recent studies in archaeal systems have demonstrated that genomic context can significantly influence protein function even when sequences are identical .

Furthermore, investigating potential post-translational modifications specific to each protein's cellular context could reveal functional specialization. Mass spectrometry approaches targeting phosphorylation, methylation, or other modifications would be valuable in this regard.

How can the thermostability properties of Sulfolobus islandicus UPF0290 protein be leveraged for biotechnological applications?

The UPF0290 protein from Sulfolobus islandicus, a hyperthermophilic archaeon that thrives at temperatures around 80-90°C and acidic pH (~3-4), possesses intrinsic thermostability that can be exploited for various biotechnological applications:

  • Protein engineering platform: The thermostable scaffold of UPF0290 can serve as a starting point for directed evolution experiments, where the protein's inherent stability provides a buffer against destabilizing mutations. This enables more extensive exploration of sequence space when engineering novel functions.

  • Biocatalysis in extreme conditions: If enzymatic activity (such as CDP-archaeol synthase activity) is confirmed, the protein could be used for high-temperature biocatalysis, which offers advantages including:

    • Increased reaction rates

    • Reduced risk of microbial contamination

    • Enhanced substrate solubility

    • Lower viscosity of reaction media

  • Methodological approaches for thermostability investigations:

    • Differential scanning calorimetry (DSC) to determine melting temperature (Tm)

    • Circular dichroism (CD) spectroscopy to monitor structural changes at different temperatures

    • Activity assays at varying temperatures to establish temperature-activity profiles

    • Site-directed mutagenesis to identify key residues contributing to thermostability

    • Molecular dynamics simulations to understand the structural basis of thermostability

  • Structure-based investigations: Comparative analysis with mesophilic homologs can identify specific structural features contributing to thermostability, such as:

    • Increased number of salt bridges

    • Enhanced hydrophobic core packing

    • Reduced surface loop flexibility

    • Prevalence of specific amino acids (e.g., increased Glu/Lys residues)

The methodological approach should involve characterizing the protein's stability profile across various conditions (temperature, pH, solvents) before attempting protein engineering or application development .

What are the optimal expression and purification protocols for obtaining high-yield, functionally active Sulfolobus islandicus UPF0290 protein?

Optimizing expression and purification of the recombinant Sulfolobus islandicus UPF0290 protein requires addressing several key challenges inherent to archaeal proteins:

Expression Protocol:

  • Vector selection: pET-based vectors with T7 promoter systems typically yield high expression levels for archaeal proteins.

  • Host strain optimization: BL21(DE3) derivatives like Rosetta or Arctic Express can enhance expression of proteins with rare codons or requiring chaperone assistance.

  • Induction conditions:

    • Temperature: 16-18°C post-induction often yields better soluble protein despite slower expression

    • IPTG concentration: 0.1-0.5 mM range, with lower concentrations favoring solubility

    • Induction duration: Extended periods (16-24 hours) at lower temperatures

Purification Strategy:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Secondary purification: Size exclusion chromatography or ion exchange chromatography

  • Buffer optimization:

    • Include stabilizing agents like glycerol (10-20%)

    • Consider archaeal-specific preferences (higher salt concentrations)

Troubleshooting Common Issues:

IssuePotential Solution
Insoluble expressionLower induction temperature; co-express with chaperones; add solubility tags (SUMO, MBP)
Poor IMAC bindingAdjust imidazole in binding buffer; check pH; ensure reducing conditions
Loss of activityInclude specific cofactors; optimize buffer conditions; minimize time at room temperature
Proteolytic degradationAdd protease inhibitors; reduce purification time; maintain cold temperatures

For activity assays, consider that the hyperthermophilic nature of this protein may require elevated temperatures (60-80°C) and acidic pH (pH 3-5) for optimal function, which differs significantly from typical mesophilic enzyme assay conditions .

How can I design experiments to elucidate the specific function of UPF0290 protein in lipid biosynthesis pathways?

To investigate the putative role of the UPF0290 protein M1627_1414 as a CDP-archaeol synthase in archaeal lipid biosynthesis, a systematic experimental approach is necessary:

  • In vitro enzymatic activity assays:

    • Substrate preparation: Synthesize or obtain archaeal phospholipid precursors

    • Reaction conditions: Test activity at elevated temperatures (60-85°C) and acidic pH (3-5)

    • Product detection: Use thin-layer chromatography (TLC), HPLC, or mass spectrometry to identify CDP-archaeol formation

    • Kinetic analysis: Determine Km, Vmax, and optimal reaction conditions

  • Genetic manipulation approaches:

    • Generate gene knockout or knockdown strains in Sulfolobus islandicus

    • Perform complementation studies with wild-type and mutated versions

    • Analyze lipid composition changes using lipidomics approaches

    • Monitor growth phenotypes under various conditions

  • Structural biology investigations:

    • Solve protein structure using X-ray crystallography or cryo-EM

    • Perform in silico docking studies with potential substrates

    • Use site-directed mutagenesis to validate catalytic residues

    • Compare with structures of known CDP-alcohol phosphatidyltransferases

  • Systems biology:

    • Transcriptomic analysis to identify co-regulated genes

    • Metabolic flux analysis using isotope-labeled precursors

    • Construct in silico models of archaeal lipid biosynthesis

  • Experimental design for testing specificity for archaeal lipids:

Substrate TypeRepresentative CompoundsAnalytical Method
Archaeal lipid precursorsGeranylgeranyl phosphate, archaeolLC-MS/MS
Bacterial lipid precursorsDiacylglycerol, phosphatidic acidTLC, GC-MS
CDP-activated compoundsCDP-diacylglycerol, CDP-archaeol31P-NMR, ESI-MS

This comprehensive approach will help distinguish whether the UPF0290 protein functions specifically in archaeal membrane lipid synthesis and elucidate its precise role in the unique lipid biosynthesis pathways of Sulfolobus islandicus .

What techniques are most effective for studying protein-protein interactions involving Sulfolobus islandicus UPF0290 protein in extremophilic contexts?

Investigating protein-protein interactions (PPIs) involving thermophilic proteins like Sulfolobus islandicus UPF0290 requires specialized approaches that account for the extreme conditions these proteins naturally function under:

  • Modified pull-down assays for thermophilic conditions:

    • Immobilize His-tagged UPF0290 protein on Ni-NTA resin

    • Prepare cell lysates from Sulfolobus islandicus grown under various conditions

    • Perform binding reactions at elevated temperatures (60-80°C)

    • Wash with high-stringency buffers containing thermostable detergents

    • Identify binding partners through mass spectrometry

  • Thermostable protein complementation assays:

    • Split-protein systems using thermostable reporters (modified GFP variants)

    • Express in either heterologous systems with heat shock or directly in thermophilic hosts

    • Measure reconstituted activity after temperature treatment

  • Cross-linking mass spectrometry (XL-MS):

    • Use thermostable cross-linking reagents that function at high temperatures

    • Perform reactions in native Sulfolobus conditions (pH 3-4, 75-85°C)

    • Analyze cross-linked peptides using specialized search algorithms optimized for archaeal proteins

  • Surface plasmon resonance (SPR) with modified protocols:

    • Thermostable chip surfaces and fluidics systems

    • Temperature-controlled binding analysis (25-90°C range)

    • Real-time measurement of association/dissociation kinetics at varying temperatures

  • Comparative effectiveness of different PPI methods for extremophilic proteins:

MethodAdvantagesLimitationsTemperature Range
Co-immunoprecipitationCan be performed with native complexesAntibody stability at high temperaturesUp to 60°C with modifications
Bacterial two-hybridGenetic screening capabilityRequires mesophilic host25-45°C
XL-MSCaptures transient interactionsComplex data analysisUp to 90°C with appropriate reagents
Isothermal titration calorimetryDirect thermodynamic measurementsRequires purified proteins25-80°C
Native PAGESimple techniqueLimited resolutionUp to 70°C

When interpreting results, it's crucial to consider that some interactions may only occur under extreme conditions that mimic the natural environment of Sulfolobus islandicus. Therefore, validation of interactions under these conditions is essential for biological relevance .

How should researchers interpret structural similarities between UPF0290 protein and other membrane-associated proteins in archaea?

When analyzing structural similarities between Sulfolobus islandicus UPF0290 protein M1627_1414 and other membrane-associated proteins in archaea, researchers should employ a systematic interpretive framework:

  • Structural homology assessment:

    • Perform structural alignment using tools like DALI, VAST, or TM-align

    • Calculate root-mean-square deviation (RMSD) values for backbone atoms

    • Identify conserved structural motifs rather than focusing solely on sequence identity

  • Membrane interaction domain analysis:

    • Examine hydrophobicity profiles using scales optimized for archaeal membrane proteins

    • Identify potential transmembrane regions using archaeal-specific prediction algorithms

    • Compare amphipathic helices that might interact with the unique archaeal lipid monolayer

  • Evolutionary context interpretation:

    • Distinguish between convergent and divergent evolution scenarios

    • Consider the archaeal-specific membrane environment (monolayer vs. bilayer)

    • Evaluate conservation patterns in the context of archaeal phylogeny

  • Function prediction framework:

    • Structural similarities may indicate functional relationships even with low sequence identity

    • Identify conserved catalytic residues or binding pockets

    • Examine structural features in the context of proposed CDP-archaeol synthase activity

The interpretation should account for unique characteristics of archaeal membrane proteins, particularly those from extremophiles like Sulfolobus islandicus. Unlike bacterial or eukaryotic membrane proteins, archaeal proteins interact with membranes composed of isoprenoid chains linked to glycerol via ether bonds rather than ester bonds, forming monolayers rather than bilayers in many cases .

When similar structural features are identified, researchers should design validation experiments that specifically test the functional significance of these features in the archaeal membrane context rather than assuming functional equivalence based on structural similarity alone.

What bioinformatic approaches can predict functional domains within the UPF0290 protein when experimental data is limited?

When faced with limited experimental data on Sulfolobus islandicus UPF0290 protein M1627_1414, researchers can employ a multi-tiered bioinformatic approach to predict functional domains:

  • Advanced sequence analysis:

    • Position-specific scoring matrices (PSSMs) and hidden Markov models (HMMs) to detect remote homologs

    • Conservation analysis across diverse archaeal lineages

    • Identification of archaeal-specific sequence motifs using MEME or related tools

    • Coevolutionary analysis to identify functionally coupled residues

  • Structural prediction and analysis:

    • Ab initio and template-based 3D structure prediction using AlphaFold2 or RoseTTAFold

    • Pocket and cavity detection to identify potential catalytic or binding sites

    • Electrostatic surface mapping at various pH values (particularly acidic pH 3-5)

    • Molecular dynamics simulations under high-temperature conditions

  • Genomic context analysis:

    • Examination of gene neighborhoods in multiple Sulfolobus species

    • Detection of conserved operonic structures

    • Phylogenetic profiling to identify co-occurring genes

  • Integrated functional prediction:

Prediction MethodInformation ProvidedReliability for Archaeal Proteins
InterProScanIntegrated domain and motif detectionMedium-High
Archaeal-specific HMMsLineage-specific functional elementsHigh
Structural similarity (DALI)Fold-based function inferenceMedium
Active site prediction (COACH)Potential catalytic residuesMedium-Low
Transmembrane topology (TMHMM)Membrane interaction regionsMedium
  • Validation strategy for predictions:

    • Cross-validation across multiple prediction methods

    • Consistency checks with the limited experimental data available

    • Comparison with better-characterized proteins in the same family

    • Design of targeted experiments to test specific predictions

The reliability of these predictions should be evaluated in the context of archaeal proteins, particularly those from extremophiles, as many bioinformatic tools were developed primarily for bacterial or eukaryotic proteins and may have reduced accuracy for archaeal systems .

What are the most promising research directions for understanding the biological significance of UPF0290 proteins in archaea?

The study of UPF0290 proteins in Sulfolobus islandicus and other archaea represents a frontier in understanding extremophile biology. Based on current knowledge, several high-priority research directions emerge:

  • Structural biology of extremophile membrane proteins:

    • Obtaining high-resolution structures of UPF0290 proteins in both apo and substrate-bound states

    • Comparative structural analysis across archaeal lineages

    • Investigation of structural adaptations to extreme conditions

  • Systems biology integration:

    • Metabolic network reconstruction focusing on archaeal-specific lipid biosynthesis

    • Multi-omics approaches (proteomics, transcriptomics, lipidomics) under varying environmental conditions

    • Synthetic biology approaches to reconstitute archaeal lipid biosynthesis in model organisms

  • Evolutionary significance:

    • Investigation of UPF0290 proteins as potential markers for archaeal membrane biosynthesis evolution

    • Comparative analysis between archaeal, bacterial, and eukaryotic phospholipid biosynthesis pathways

    • Exploration of horizontal gene transfer events involving these proteins

  • Biotechnological applications:

    • Engineering UPF0290 proteins for biocatalysis at extreme temperatures

    • Development of archaeal lipid production systems for specialized applications

    • Investigation of potential roles in extremozyme stabilization

The advancement of these research areas would benefit from developing better genetic tools for Sulfolobus species and other extremophiles, as well as specialized biochemical assays that can function under extreme conditions. Collaborative approaches combining expertise in archaeal biology, structural biology, and synthetic biology will likely yield the most significant advances in understanding these fascinating proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.