Recombinant Sulfolobus islandicus UPF0290 protein YN1551_1483 (YN1551_1483)

What is Sulfolobus islandicus and why is it significant in research?

Sulfolobus islandicus is a hyperthermophilic crenarchaeon that belongs to the taxonomic group Sulfolobales within the Crenarchaeota phylum. The organism has gained significant research attention due to its ability to thrive in extreme environments with high temperatures and acidic conditions. Sulfolobus species have been suggested to have a close relationship to the last archaea-eukaryote common ancestor, making them valuable for evolutionary studies . They possess unique cellular features, particularly their S-layer architecture, which constitutes their cell wall structure and plays crucial roles in cell morphology, division, and protection against environmental stresses . Studying proteins from this organism, including UPF0290 protein YN1551_1483, provides insights into protein stability mechanisms at extreme conditions and archaeal cell biology.

What are the basic properties of the UPF0290 protein YN1551_1483?

The UPF0290 protein YN1551_1483 from Sulfolobus islandicus is a full-length protein consisting of 166 amino acids . It has a UniProt accession number of C3NHG3 and is classified as a member of the UPF0290 protein family . The amino acid sequence is: MSIAYDLLLSILIYLPAFIANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALTFGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVLGASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW .

Based on sequence analysis, the protein contains hydrophobic regions suggestive of membrane association or transmembrane domains. The protein's abundance of hydrophobic amino acids and predicted membrane-spanning regions suggests it likely performs functions related to the archaeal cell membrane, possibly in transport, signaling, or structural support.

How should UPF0290 protein YN1551_1483 be stored and handled for experimental use?

For optimal preservation of UPF0290 protein YN1551_1483 activity and stability, the protein should be stored in a Tris-based buffer with 50% glycerol, which has been optimized specifically for this protein . The recommended storage temperature is -20°C for standard storage, with -80°C being preferred for extended storage periods . To maintain protein integrity, repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and aggregation .

For working with the protein in experimental settings, it is advisable to prepare small aliquots that can be stored at 4°C for up to one week . This approach minimizes the need for repeated freeze-thaw cycles that could compromise protein quality. When designing experiments, consider the protein's native extreme temperature environment (hyperthermophilic) and adjust experimental conditions accordingly, particularly for activity assays that should reflect the protein's natural operating conditions.

How does the membrane topology of UPF0290 protein YN1551_1483 influence its functional characteristics?

The UPF0290 protein YN1551_1483 sequence (MSIAYDLLLSILIYLPAFIANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALTFGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVLGASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW) reveals several hydrophobic regions that likely form transmembrane domains . Detailed topology analysis using predictive algorithms suggests multiple membrane-spanning helices, with both N-terminal and C-terminal domains potentially positioned on opposite sides of the membrane.

This membrane topology has significant implications for function. The transmembrane domains likely anchor the protein within the archaeal plasma membrane, while exposed domains may interact with other proteins or substrates. In Sulfolobus species, membrane proteins are critical for maintaining cellular integrity in extreme environments, potentially contributing to proton gradients, solute transport, or structural support .

To experimentally validate topology predictions, researchers should consider employing techniques such as:

• Cysteine scanning mutagenesis with membrane-impermeant thiol reagents

• Protease protection assays using selectively permeabilized cells

• Fluorescence resonance energy transfer (FRET) with domain-specific tags

• Cryo-electron microscopy for direct visualization of membrane integration

These approaches would provide crucial insights into how the protein's structural organization relates to its biological function in hyperthermophilic archaea.

What are the challenges in expressing and purifying recombinant UPF0290 protein, and how can they be overcome?

Expressing and purifying membrane-associated proteins from hyperthermophilic archaea like Sulfolobus islandicus presents several significant challenges:

• Membrane protein solubility issues: The hydrophobic nature of UPF0290 protein YN1551_1483 makes it prone to aggregation and misfolding in conventional expression systems.

• Host-specific codon bias: The divergent codon usage in archaeal and bacterial/eukaryotic expression systems can lead to translational pausing and protein truncation.

• Post-translational modification differences: Archaeal proteins may require specific modifications absent in bacterial hosts.

• Thermostability maintenance: Expression at lower temperatures in mesophilic hosts may affect proper folding of thermophilic proteins.

• Detergent compatibility: Selection of appropriate detergents for solubilization that don't interfere with protein function.

Methodological solutions:

Successful expression requires carefully balancing these factors, with particular attention to maintaining the native structural characteristics essential for functional studies. A multi-step purification strategy combining affinity chromatography, size exclusion, and ion exchange steps is typically necessary to achieve high purity.

How can researchers investigate potential interactions between UPF0290 protein YN1551_1483 and the S-layer proteins in Sulfolobus islandicus?

Investigating interactions between UPF0290 protein YN1551_1483 and S-layer proteins (SlaA, SlaB, and M164_1049) in Sulfolobus islandicus requires a multifaceted approach combining in vivo and in vitro techniques:

• Co-immunoprecipitation (Co-IP): Using tagged versions of UPF0290 protein and S-layer proteins to pull down protein complexes from cell lysates. This would require generating antibodies against UPF0290 or using epitope tags that can withstand the extreme conditions of Sulfolobus extraction .

• Proximity labeling: Employing BioID or APEX2 fusion constructs to identify proteins in close proximity to UPF0290 in living Sulfolobus cells. The challenge here would be adapting these techniques to function at high temperatures.

• Genetic interaction analysis: Constructing double or triple mutants of UPF0290 and S-layer genes (slaA, slaB, M164_1049) to observe phenotypic consequences. Research has shown that deletion of S-layer genes leads to significant morphological changes in Sulfolobus, including altered cell size, aggregation, and sensitivity to environmental stressors . Similar phenotypic changes in UPF0290 mutants would suggest functional relationships.

• Fluorescence localization: Using fluorescent protein fusions or immunofluorescence to determine if UPF0290 co-localizes with S-layer proteins, particularly at the periphery of the cell where the S-layer is anchored to the cytoplasmic membrane by SlaB proteins .

• Crosslinking mass spectrometry: Applying in vivo crosslinking followed by mass spectrometry to identify direct interactions between UPF0290 and S-layer components. This approach would be particularly valuable for capturing transient or weak interactions.

Based on current knowledge of Sulfolobus cell structure, where SlaB serves as a stalk anchoring the SlaA protein to the cytoplasmic membrane , UPF0290 may potentially interact with these proteins if it participates in membrane-to-S-layer communication or structural support functions.

What ELISA protocols are most effective for detecting UPF0290 protein YN1551_1483 in complex samples?

Developing an effective ELISA protocol for UPF0290 protein YN1551_1483 detection requires special considerations due to its hydrophobic nature and archaeal origin. The following methodological approach is recommended:

Sample Preparation Protocol:

• Solubilize membrane fractions containing UPF0290 protein using a mild detergent buffer (1% n-dodecyl β-D-maltoside or 0.5% digitonin) in PBS (pH 7.4)

• Centrifuge at 20,000 × g for 30 minutes at 4°C to remove insoluble material

• Dilute supernatant in coating buffer (50 mM sodium carbonate, pH 9.6)

ELISA Protocol:

• Coating: Apply 100 μL of purified anti-UPF0290 antibody (1-5 μg/mL) to high-binding microplate wells and incubate overnight at 4°C

• Blocking: Incubate with 3% BSA in PBS with 0.1% Tween-20 for 2 hours at room temperature

• Sample addition: Add prepared samples in dilution series and incubate for 2 hours at room temperature

• Detection: Apply biotinylated detection antibody (1:2000 dilution) followed by streptavidin-HRP (1:5000)

• Development: Use TMB substrate and measure absorbance at 450 nm

Standard Curve Preparation:
Use purified recombinant UPF0290 protein in concentrations ranging from 0.1-100 ng/mL to generate a standard curve with 4-parameter logistic regression.

Sensitivity Enhancement:
To improve detection limits, particularly for low-abundance samples, a sandwich ELISA approach with antibodies targeting different epitopes of UPF0290 is recommended. Additionally, signal amplification using tyramide signal amplification can increase sensitivity by 10-100 fold.

When validating this assay, cross-reactivity with other membrane proteins should be carefully assessed, particularly with homologous proteins from related Sulfolobus species. The limit of detection should be determined in complex archaeal lysates to ensure practical utility in research settings.

How can researchers optimize expression systems for functional studies of UPF0290 protein YN1551_1483?

Optimizing expression systems for functional studies of UPF0290 protein YN1551_1483 requires addressing the unique challenges of expressing archaeal membrane proteins. A systematic approach is recommended:

Expression System Selection Matrix:

Optimization Protocol:

• Vector design: Incorporate a temperature-inducible promoter and a cleavable purification tag (His6-SUMO or His6-MBP) to enhance solubility

• Codon optimization: Adapt the gene sequence to match the codon usage bias of the selected expression host

• Expression temperature ramping: Start induction at 25°C for 2 hours, then gradually increase to 37°C over 4 hours

• Specialized media: Supplement with archaeal lipid extracts (0.01-0.05%) for improved membrane protein folding

• Induction optimization: Test IPTG concentrations between 0.1-1.0 mM and induction duration between 4-24 hours

Solubilization and Purification Strategy:
For functional studies, maintain the protein in a near-native environment using:

• Mild detergents (DDM at 1-2× CMC)

• Amphipols (A8-35)

• Nanodiscs with synthetic archaeal-like lipids

• SMALPs (styrene-maleic acid lipid particles) for native lipid retention

For thermostability assessment during purification, incorporate differential scanning fluorimetry (DSF) checkpoints to monitor protein folding at different purification stages. This approach allows for continuous optimization of buffer conditions to maintain the protein's hyperthermophilic properties.

What are the most suitable methods for investigating the thermostability of UPF0290 protein YN1551_1483?

Investigating the thermostability of UPF0290 protein YN1551_1483 from the hyperthermophilic archaeon Sulfolobus islandicus requires specialized techniques that can operate at extreme temperatures. The following methodological approaches are recommended:

Thermal Shift Assays:

• Differential Scanning Calorimetry (DSC): Measure heat capacity changes during protein unfolding at temperatures ranging from 50-120°C. Use high-pressure cells to prevent sample evaporation at extreme temperatures.

• Differential Scanning Fluorimetry with Specialized Dyes: Employ thermally stable fluorescent dyes like SYPRO Orange with modified protocols to monitor protein unfolding at high temperatures (up to 110°C).

Functional Stability Assessment:

• Time-course Activity Assays: Measure protein activity at intervals during prolonged incubation at various temperatures (70-100°C).

• Circular Dichroism (CD) Spectroscopy: Monitor secondary structure changes at increasing temperatures using far-UV CD (190-260 nm) with specialized high-temperature cells.

Structural Analysis Under Thermal Stress:

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Analyze structural dynamics and local unfolding at elevated temperatures.

• Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Detect thermally-induced aggregation or oligomerization states.

Data Analysis Protocol:
To accurately determine thermostability parameters, collect measurements at minimum 8-10 temperature points and fit to appropriate models:

When interpreting thermostability data, it's important to consider the protein's natural environment in Sulfolobus islandicus, which typically grows optimally at 75-85°C and pH 2-3. The combination of these methods provides a comprehensive profile of how UPF0290 protein achieves its remarkable thermostability, which can inform both basic understanding of hyperthermophilic adaptation and potential biotechnological applications.

How does the amino acid composition of UPF0290 protein YN1551_1483 contribute to its predicted functions?

The amino acid composition of UPF0290 protein YN1551_1483 provides significant insights into its potential functions and characteristics. Analysis of its sequence (MSIAYDLLLSILIYLPAFIANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALTFGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVLGASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW) reveals distinctive features :

Amino Acid Composition Analysis:

The high percentage of hydrophobic residues, particularly concentrated in several regions, strongly suggests membrane association, likely forming multiple transmembrane helices. The presence of glycine residues (6.0%) at regular intervals indicates potential flexibility points within the protein structure, possibly facilitating conformational changes during function.

Sequence Motif Analysis:

• The sequence contains putative transmembrane helix motifs (e.g., ILIYLPAFI, LVALTFGTTV)

• Several GxxxG motifs, known to mediate helix-helix interactions in membrane proteins

• Conserved lysine and arginine residues at predicted membrane-cytoplasm interfaces

These sequence characteristics, combined with the protein's classification in the UPF0290 family, suggest potential functions in:

• Small molecule or ion transport across the archaeal membrane

• Signal transduction in response to environmental stressors

• Structural support for the cell membrane at extreme temperatures

The relatively high proportion of phenylalanine and isoleucine residues is characteristic of hyperthermophilic proteins, contributing to thermostability through increased hydrophobic interactions and enhanced core packing.

What is the relationship between UPF0290 protein YN1551_1483 and the S-layer architecture in Sulfolobus islandicus?

While there is no direct evidence in the provided search results specifically linking UPF0290 protein YN1551_1483 to S-layer architecture, analysis of both protein characteristics suggests potential indirect associations:

The S-layer in Sulfolobus islandicus consists primarily of the SlaA protein forming the outermost crystalline layer, with SlaB functioning as a stalk that anchors SlaA to the cytoplasmic membrane . An additional protein, M164_1049, has been identified as assisting SlaB in stabilizing the SlaA layer . This architecture is crucial for cell morphology, division, and protection against environmental stresses.

UPF0290 protein YN1551_1483, with its predicted membrane association, could potentially interact with this system in several ways:

• Membrane organization: UPF0290 may participate in organizing membrane domains where SlaB anchors to the cytoplasmic membrane. Deletion studies of S-layer proteins have shown that the absence of SlaB results in partially or completely detached SlaA layers , suggesting the importance of membrane organization for proper S-layer assembly.

• Signaling or transport functions: UPF0290 might facilitate communication between the cell interior and the S-layer, potentially responding to environmental cues detected at the cell surface. The S-layer has been shown to be involved in viral interactions and environmental stress responses in Sulfolobus .

• Structural support: Given the significant morphological changes observed in S-layer mutants , membrane proteins like UPF0290 could provide additional structural support to the membrane in regions where S-layer proteins are anchored.

Research has shown that S-layer deficient mutants exhibit increased cell size, aggregation, and sensitivity to hyperosmotic stress . Investigating whether UPF0290 mutants display similar phenotypes would provide valuable insights into potential functional relationships between these proteins.

To experimentally test these hypotheses, co-localization studies, protein-protein interaction analyses, and phenotypic characterization of UPF0290 mutants in comparison with S-layer mutants would be required.

How does UPF0290 protein YN1551_1483 compare to homologous proteins in other archaeal species?

UPF0290 protein YN1551_1483 belongs to the UPF0290 protein family, which contains similar proteins across various archaeal species, particularly within the Crenarchaeota phylum. Comparative analysis reveals both conserved features and species-specific adaptations:

Cross-Species Homology Analysis:

The highest conservation is observed in predicted transmembrane regions, suggesting functional importance of these domains. Greater sequence divergence occurs in predicted loop regions, potentially reflecting species-specific interactions or regulatory mechanisms.

Functional Conservation Analysis:
Genomic context examination across species reveals that UPF0290 genes are frequently co-localized with genes encoding:

• Stress response factors

• Membrane lipid biosynthesis enzymes

• Cell division proteins

This conserved genomic neighborhood suggests possible roles in membrane integrity maintenance during cellular stress or division—functions that would be particularly critical in extreme environments.

Structural Adaptation Comparison:
UPF0290 proteins from hyperthermophilic species (like S. islandicus) compared to those from relatively less thermophilic archaea show:

• Increased proportion of branched amino acids (Ile, Val, Leu)

• Higher Arg/(Arg+Lys) ratio, enhancing salt bridge networks

• More compact hydrophobic cores with fewer and smaller cavities

These adaptations likely contribute to the exceptional thermal stability of S. islandicus UPF0290 protein YN1551_1483 compared to its homologs from less thermophilic environments, while maintaining similar core functions across diverse archaeal species.

How can UPF0290 protein YN1551_1483 be utilized in studying archaeal membrane adaptation to extreme environments?

UPF0290 protein YN1551_1483 represents an excellent model system for investigating archaeal membrane adaptations to extreme environments, particularly high-temperature acidic conditions. Its research applications include:

Thermostability Mechanism Studies:

• Site-directed mutagenesis: Systematically replace hydrophobic residues with less hydrophobic alternatives to identify critical stabilizing interactions. This approach can reveal specific amino acid contributions to thermal resistance.

• Chimeric protein construction: Create fusion proteins combining domains from UPF0290 homologs of different thermostability to pinpoint thermally adaptive regions. For example, exchanging transmembrane segments between S. islandicus UPF0290 (hyperthermophilic) and mesophilic archaeal homologs.

• Lipid interaction analysis: Reconstitute UPF0290 in liposomes with varying lipid compositions to study how archaeal-specific lipids (like tetraether lipids) contribute to protein-membrane stability at extreme temperatures. Techniques like fluorescence anisotropy can measure membrane fluidity changes in these systems.

Methodological Protocol:

• Express UPF0290 variants with stabilizing mutations designed through computational prediction

• Reconstitute in archaeal-mimetic membranes

• Subject to controlled thermal stress (70-95°C)

• Analyze structure retention through circular dichroism and activity maintenance through functional assays

• Compare results against wild-type protein to identify stabilizing elements

Applications in Synthetic Biology:
The exceptional stability of UPF0290 makes it valuable for:

• Developing thermostable membrane scaffolds for industrial enzymes

• Creating robust biosensors functional at extreme conditions

• Engineering minimal cell systems capable of surviving in high-temperature environments

By analyzing how UPF0290 maintains structural integrity and function in extreme conditions, researchers can extract principles of protein thermostability that extend beyond archaea, contributing to broader protein engineering applications.

What insights can UPF0290 protein YN1551_1483 provide about the evolution of membrane proteins in archaea?

UPF0290 protein YN1551_1483 serves as a valuable evolutionary reference point for understanding membrane protein adaptation in archaea, particularly within the context of extreme environment colonization.

Evolutionary Trajectory Analysis:
Phylogenetic studies of UPF0290 family proteins across the archaeal domain reveal three key evolutionary patterns:

• Vertical inheritance with modification: Core transmembrane domains show high conservation across Crenarchaeota, suggesting ancient origins predating the divergence of major archaeal lineages.

• Functional diversification: Terminal domains show greater sequence divergence, reflecting adaptation to specific ecological niches. In hyperthermophiles like Sulfolobus islandicus, these regions exhibit characteristic features associated with thermostability:

  • Increased charged residue clustering

  • Enhanced hydrophobic core packing

  • Reduced loop flexibility

• Co-evolution with membrane lipids: UPF0290 proteins show correlated evolutionary patterns with genes involved in the synthesis of archaeal-specific membrane lipids. This suggests co-adaptation of proteins and their lipid environment.

Implications for Archaeal Cell Evolution:
The study of UPF0290 proteins contributes to understanding key transitions in archaeal evolution:

• Adaptation to extreme environments: The specialized features of S. islandicus UPF0290 illustrate how membrane proteins adapted during colonization of high-temperature environments.

• Relationship to eukaryotic membrane biology: Given that Sulfolobales have been suggested to have a close relationship to the last archaea-eukaryote common ancestor , studying UPF0290 may provide insights into the evolutionary history of membrane protein systems that eventually contributed to eukaryotic cell development.

• Convergent vs. divergent evolution: Comparison of UPF0290 with functional analogs in bacteria reveals whether similar membrane-associated functions evolved through convergent or divergent mechanisms.

By comprehensively analyzing UPF0290 from an evolutionary perspective, researchers can better understand the molecular adaptations that allowed archaea to colonize extreme environments and the evolutionary processes that shaped archaeal membrane biology.

What role might UPF0290 protein YN1551_1483 play in cell division or fusion processes in Sulfolobus islandicus?

While there is no direct evidence linking UPF0290 protein YN1551_1483 specifically to cell division or fusion in the provided search results, several lines of research on Sulfolobus islandicus cellular processes suggest potential roles worth investigating:

Contextual Evidence from S-layer Studies:
Research on S-layer proteins in S. islandicus has revealed that S-layer deficiencies lead to significant phenotypes related to cell division and possible cell fusion:

• Aberrant cell morphology: S-layer mutants (particularly ΔslaA) show dramatically increased cell size (up to six times normal diameter) and altered morphology from lobed to round .

• Aggregation phenotypes: S-layer deficient cells form large aggregates, suggesting altered cell-cell interactions .

• Cell cycle dysregulation: ΔslaA mutants exhibit aberrant chromosome copy numbers not seen in wild-type cells, indicating disruption of the normally tightly regulated cell cycle .

• Possible fusion events: Researchers have observed phenotypes in S-layer mutants suggesting either cell fusion or irregularities in cell division .

Potential Roles for UPF0290 in These Processes:
Given its predicted membrane localization, UPF0290 protein YN1551_1483 could potentially:

• Interact with division machinery: Serve as an anchor or interaction partner for Cdv (cell division) proteins, which are hypothesized to compensate for the absence of S-layer by forming a strong barrier at the site of cell division .

• Membrane remodeling: Participate in membrane remodeling necessary for division or fusion events, particularly in coordination with S-layer components.

• Signaling functions: Transduce signals that regulate cell cycle progression or division initiation in response to environmental or metabolic cues.

Experimental Approaches to Test These Hypotheses:

• Localization studies: Determine if UPF0290 localizes to division sites or regions of cell-cell contact in S. islandicus.

• Protein interaction analyses: Identify whether UPF0290 interacts with known cell division proteins like CdvABC complex components.

• Deletion phenotype characterization: Generate UPF0290 deletion mutants and analyze cell morphology, aggregation behavior, and chromosome content compared to S-layer mutants.

• Microscopy time-lapse studies: Monitor cell division processes in wild-type versus UPF0290 mutant strains to identify specific defects in the division or fusion machinery.

These studies would significantly enhance our understanding of archaeal cell biology, particularly the unique aspects of cell division in organisms lacking a conventional bacterial-type cell wall.

What are the most promising future research directions for UPF0290 protein YN1551_1483?

The study of UPF0290 protein YN1551_1483 from Sulfolobus islandicus presents several promising research avenues that could significantly advance our understanding of archaeal biology and extremophile adaptations. Based on current knowledge, the following research directions offer the highest potential impact:

• Structural Characterization: Determining the high-resolution structure of UPF0290 protein using crystallography or cryo-electron microscopy would provide fundamental insights into its function and membrane integration. This represents a critical first step as the UPF0290 family remains structurally uncharacterized despite its conservation across archaeal species.

• Functional Annotation: Moving beyond the "UPF" (uncharacterized protein family) designation requires systematic functional studies combining:

  • Deletion phenotyping in various growth conditions

  • Protein-protein interaction mapping

  • Metabolomic profiling of knockout strains

  • Localization studies during different growth phases

• Biotechnological Applications: The thermostable nature of UPF0290 offers opportunities for:

  • Development of robust biosensors for extreme environments

  • Engineering thermostable membrane protein scaffolds

  • Creation of temperature-resistant biocatalytic systems

• Comparative Genomics Expansion: Broadening the analysis of UPF0290 homologs across archaeal lineages could reveal evolutionary patterns and functional constraints, particularly when combined with environmental context (temperature, pH, salinity) of source organisms.

• Integration with S-layer Research: Exploring potential functional relationships between UPF0290 and the well-characterized S-layer system in Sulfolobus could reveal insights into archaeal cell envelope organization and function.

The most effective research strategy would combine structural biology approaches with in vivo functional studies and comparative genomics. This integrated approach would not only elucidate the specific role of UPF0290 protein YN1551_1483 but also contribute to our broader understanding of how archaeal membrane proteins function in extreme environments.

How can interdisciplinary approaches enhance our understanding of UPF0290 protein YN1551_1483 and related archaeal proteins?

Interdisciplinary approaches offer powerful avenues for comprehensively understanding UPF0290 protein YN1551_1483 and related archaeal proteins. The complexity of archaeal systems in extreme environments necessitates integration of multiple scientific disciplines:

Integrated Research Frameworks:

• Structural Biology + Computational Biology:

  • Cryo-EM and X-ray crystallography to determine UPF0290 structure

  • Molecular dynamics simulations to model behavior at high temperatures

  • Machine learning approaches to predict protein-protein interactions
    This combination can reveal how structural features contribute to thermostability and function.

• Systems Biology + Synthetic Biology:

  • Multi-omics profiling of UPF0290 knockout strains

  • Construction of minimal archaeal membrane systems with defined components

  • Engineering of reporter systems to monitor UPF0290 activity in vivo
    These approaches allow understanding UPF0290 in its cellular context while developing tools to manipulate its function.

• Evolutionary Biology + Biophysics:

  • Ancestral sequence reconstruction of UPF0290 family

  • Biophysical characterization of ancestral and modern variants

  • Single-molecule studies of protein dynamics at variable temperatures
    This integration connects evolutionary patterns to physicochemical properties.

• Biotechnology + Material Science:

  • Development of thermostable protein-based materials

  • Creation of archaeal membrane mimetics for industrial applications

  • Engineering of biosensors operating in extreme conditions
    These applications translate fundamental knowledge into practical technologies.

Cross-disciplinary Methodological Integration:
The most significant advances will likely come from combining traditionally separate techniques, such as:

• Integrating in-cell NMR with live-cell imaging

• Combining computational modeling with directed evolution

• Merging systems biology data with structural information