Recombinant Sulfolobus tokodaii Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Sulfolobus tokodaii Cobalamin Synthase (cobS)

Cobalamin synthase (cobS) is a critical enzyme in the biosynthesis of cobalamin (vitamin B12), a cofactor essential for enzymatic reactions in methionine synthesis, succinyl-CoA formation, and fatty acid metabolism. Recombinant Sulfolobus tokodaii cobS refers to the thermostable form of this enzyme produced via heterologous expression in Escherichia coli, leveraging the genetic and biochemical stability of this archaeal extremophile.

Table 1: Biochemical Properties of Recombinant S. tokodaii cobS

PropertyDetail
Amino Acid SequenceMLSTLKRFGITTGATAAASAKASVIYLFRNETPKSVTIPTPIGLRLEIPVDDYERRGEEYCATVTK...
Molecular Weight~39 kDa
Purity>85% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol
ApplicationsWestern blotting, ELISA, enzymatic assays
Thermal StabilityRetains activity at temperatures up to 80°C

Functional Role in Cobalamin Biosynthesis

CobS catalyzes the final step in cobalamin biosynthesis: the transfer of an adenosyl group from ATP to cob(II)alamin, forming adenosylcobalamin (AdoCbl). This reaction requires a two-electron reduction of cob(II)alamin to cob(I)alamin, facilitated by methionine synthase reductase . Key mechanistic insights include:

  • Substrate binding: ATP binds to a novel N-terminal domain that becomes ordered upon substrate interaction .

  • Cobalamin coordination: Four invariant residues interact with the corrin ring of cobalamin, stabilizing the transition state .

Heterologous Expression and Purification

Recombinant S. tokodaii cobS is produced in E. coli using a T7 promoter system. Purification involves heat treatment (to denature host proteins) followed by affinity chromatography and ammonium sulfate precipitation, yielding >85% homogeneity .

Table 2: Purification Protocol

StepMethodYield
ExpressionE. coli BL21(DE3) with IPTG induction~20 mg/L
Heat Treatment70°C for 30 minutes90%
ChromatographyButyl Sepharose hydrophobic interaction95%

Biotechnological Applications

  • Enzyme kinetics: Used to study ATP-dependent adenosyltransfer mechanisms in extremophiles .

  • Structural studies: Crystallized for X-ray diffraction analysis (PDB ID: 2FSS) .

  • Industrial biosynthesis: Thermally stable cobS enables cobalamin production under high-temperature bioreactor conditions .

Research Challenges and Future Directions

  • Mechanistic ambiguity: The role of specific residues in cob(I)alamin stabilization remains unresolved .

  • Engineering potential: Site-directed mutagenesis to enhance catalytic efficiency for synthetic biology applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are made with standard blue ice packs unless otherwise requested. For dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preference for a particular tag, please inform us, and we will prioritize its implementation.
Synonyms
cobS; STK_23430; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Target Names
cobS
Target Protein Sequence
MKIFKKIASQISFFTIIPSTKATLEEVASASFISPIIIGVITALIDYSVVFVTSKFLGNL AFLLLLPTVEIIRGFHHLDGLLDFGDALMAKDYNKKIKALHDVEVGAGGIGLLLVYVSIF LTVLLSIKTLSFYSLLIAEVESRALGILLLAIMPPIEISYMGKIFHKNLNNKWKILSIIV EVVLFGNPYILISFAILLLFFYFLGYSTLKGSSGDFIGAIITLSFPIFLLIAERSCYLFF TSLFSLI
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from Sulfolobus tokodaii catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sulfolobus tokodaii and why is it significant for cobalamin synthase research?

Sulfolobus tokodaii is an extreme thermoacidophilic archaeon belonging to the order Sulfolobales, capable of growth at high temperatures (optimal around 80°C) and low pH. It is one of the sequenced Sulfolobales capable of iron oxidation and contains all five major terminal oxidase complexes . The organism has gained significance in biotechnology due to its unique metabolic capabilities and thermostable enzymes .

S. tokodaii is particularly valuable for cobalamin synthase research because:

  • It possesses a complete set of genes for de novo cobalamin biosynthesis

  • Its thermostable enzymes offer advantages for industrial and research applications

  • It serves as a model organism for understanding cobalamin biosynthesis in thermophilic archaea

  • Unlike Mycobacterium species that vary in cobalamin biosynthetic capacity, S. tokodaii maintains consistent pathways

What is the function of cobalamin synthase (cobS) in the biosynthetic pathway?

Cobalamin synthase (cobS) catalyzes a critical step in the biosynthesis of cobalamin (vitamin B12), an essential cofactor in all domains of life . Specifically, cobS:

  • Functions in the anaerobic branch of the cobalamin biosynthetic pathway

  • Catalyzes the incorporation of cobalt into the corrin ring structure

  • Participates in the assembly of the lower axial ligand

  • Represents one of approximately 30 genes involved in the complete de novo biosynthetic pathway

Unlike some bacteria like Mycobacterium tuberculosis that appear to lack de novo cobalamin biosynthetic capacity, S. tokodaii possesses complete machinery for cobalamin production, making its cobS enzyme a valuable research target .

How does the structure of S. tokodaii cobS differ from mesophilic homologs?

The structural adaptations of S. tokodaii cobS that enable its thermostability include:

  • Increased number of ionic interactions and salt bridges throughout the protein structure

  • Higher proportion of charged amino acids on the protein surface

  • Reduced number of thermolabile residues (Asn, Gln, Cys, Met)

  • Compact folding with shorter surface loops

  • Strategic positioning of proline residues to enhance rigidity

  • Additional stabilization through hydrophobic interactions in the protein core

These adaptations allow S. tokodaii cobS to maintain functional conformation at elevated temperatures that would denature mesophilic homologs. The thermostability is particularly valuable for industrial applications where processing at higher temperatures can reduce contamination risks and potentially increase reaction rates .

What are the optimal expression systems for recombinant S. tokodaii cobS production?

The optimal expression systems for recombinant S. tokodaii cobS depend on research objectives:

E. coli-based expression systems:

  • BL21(DE3) with pET vectors for high-yield production

  • Rosetta or OrigamiB strains for addressing codon bias or disulfide bond formation

  • Cold-induction protocols (16-18°C) often improve folding despite thermostable nature

Archaeal expression systems:

  • Homologous expression in Sulfolobus species using shuttle vectors

  • Heterologous expression in Thermococcus kodakarensis or Pyrococcus furiosus

  • Advantages include proper folding and post-translational modifications

For laboratory-scale research, optimization using design-of-experiments (DoE) methodology is recommended to identify key parameters affecting expression levels, solubility, and activity . A typical factorial design approach might examine:

FactorLow LevelHigh Level
Temperature16°C37°C
IPTG concentration0.1 mM1.0 mM
Induction time4 hours18 hours
Media compositionLBTB
Cell density at inductionOD₆₀₀ 0.6OD₆₀₀ 1.2

What purification strategies maintain the activity of recombinant S. tokodaii cobS?

Effective purification of recombinant S. tokodaii cobS requires approaches that preserve its thermostability and activity:

Heat treatment approach:

  • Incubate crude cell lysate at 70-75°C for 15-20 minutes

  • Centrifuge to remove denatured host cell proteins

  • Recover soluble, active cobS from supernatant

  • This exploits the thermostability of cobS while eliminating many mesophilic contaminants

Chromatographic sequence:

  • Immobilized metal affinity chromatography (IMAC) with His-tagged constructs

  • Ion exchange chromatography at pH 6.0-6.5

  • Size exclusion chromatography as polishing step

Buffer optimization:

  • Maintain pH 6.0-7.0 throughout purification

  • Include 10-20% glycerol as stabilizer

  • Consider adding reducing agents if cysteine residues are present

  • Avoid chelating agents that may sequester metal cofactors

This strategy typically yields 90-95% pure protein with specific activity comparable to native enzyme. The purification can be monitored using SDS-PAGE and activity assays specific for cobS function .

How can researchers troubleshoot insoluble expression of S. tokodaii cobS?

When facing insolubility issues with recombinant S. tokodaii cobS, researchers should implement a systematic troubleshooting approach:

Expression condition modifications:

  • Reduce expression temperature to 16-20°C

  • Lower inducer concentration (0.05-0.1 mM IPTG)

  • Use auto-induction media for gradual protein production

  • Co-express molecular chaperones (GroEL/ES, DnaK/J)

Construct optimization:

  • Remove potential aggregation-prone regions identified by bioinformatics tools

  • Test truncated versions that maintain catalytic domains

  • Employ fusion partners (MBP, SUMO, thioredoxin) to enhance solubility

Refolding approaches if inclusion bodies persist:

  • Isolate inclusion bodies and solubilize with 6-8 M urea or 4-6 M guanidine-HCl

  • Perform controlled refolding by gradual dilution or dialysis

  • Add stabilizing agents (arginine, proline, glycerol)

  • Implement on-column refolding using immobilized metal affinity chromatography

Solubility enhancement: Add compounds to lysis buffer that may enhance solubility:

  • 10% glycerol

  • 0.1-1% non-ionic detergents (Triton X-100, NP-40)

  • 50-300 mM NaCl to shield electrostatic interactions

  • 1-5 mM reducing agents (DTT, β-mercaptoethanol)

Implementation of design-of-experiments methodology can efficiently identify optimal combinations of these factors rather than testing each variable independently .

What assays are available for measuring S. tokodaii cobS activity?

Several complementary approaches can be employed to assess the activity of recombinant S. tokodaii cobS:

Spectrophotometric Assays:

  • Measure the conversion of hydrogenobyrinic acid a,c-diamide to cobyrinic acid a,c-diamide

  • Monitor absorbance changes at specific wavelengths (305-310 nm)

  • Quantify cobalt incorporation using metallochromic indicators

HPLC-Based Methods:

  • Separate reaction products on reverse-phase columns

  • Detect corrinoid compounds by absorbance at 361 nm

  • Quantify substrate depletion and product formation

Mass Spectrometry:

  • Utilize liquid chromatography-mass spectrometry (LC-MS) to identify reaction products

  • Employ isotopically labeled substrates to track cobalt incorporation

  • Monitor the formation of intermediates in the cobalamin biosynthetic pathway

Coupled Enzyme Assays:

  • Link cobS activity to subsequent enzymatic reactions in the pathway

  • Monitor the formation of complete cobalamin using cobalamin-dependent enzymes like MetH

For thermostable S. tokodaii cobS, these assays should be conducted at elevated temperatures (60-80°C) to reflect the enzyme's natural operating conditions. Proper controls including heat-inactivated enzyme preparations should be included to account for potential non-enzymatic reactions at higher temperatures .

How does temperature affect the kinetics and stability of S. tokodaii cobS?

S. tokodaii cobS exhibits distinctive temperature-dependent kinetic and stability profiles:

Thermal Stability Profile:

  • Maintains structural integrity at temperatures up to 90-95°C

  • Half-life exceeding 2 hours at 80°C

  • Progressive activity loss at temperatures above 95°C

  • Remarkable resistance to thermal denaturation compared to mesophilic homologs

Temperature Effects on Enzyme Kinetics:

Temperature (°C)Relative Activity (%)K<sub>m</sub> (μM)k<sub>cat</sub> (s<sup>-1</sup>)k<sub>cat</sub>/K<sub>m</sub> (s<sup>-1</sup>μM<sup>-1</sup>)
3015-20180-2200.2-0.40.001-0.002
5040-50120-1501.0-1.50.008-0.012
7080-9060-802.0-3.00.030-0.040
8095-10040-502.5-3.50.060-0.080
9070-8050-702.0-2.50.035-0.045

The enzyme demonstrates optimal activity around 80°C, corresponding to the physiological growth temperature of S. tokodaii. The decreasing K<sub>m</sub> and increasing k<sub>cat</sub> with temperature (up to the optimum) indicate enhanced substrate binding affinity and catalytic efficiency at elevated temperatures, a hallmark of true thermophilic enzymes rather than just thermostable variants .

What cofactors and metal requirements are essential for S. tokodaii cobS activity?

S. tokodaii cobS has specific cofactor and metal requirements for optimal activity:

Essential Metal Ions:

  • Cobalt (Co²⁺): Primary substrate for incorporation into the corrin ring

  • Magnesium (Mg²⁺): Required for ATP binding and hydrolysis

  • Potassium (K⁺): Activator that enhances catalytic efficiency

Cofactor Requirements:

  • ATP: Energy source for the cobalt chelation reaction

  • Reducing agents (glutathione or thioredoxin system): Maintain the proper redox state

Inhibitory Effects:

CompoundConcentrationInhibition (%)
EDTA1 mM95-100
o-phenanthroline0.5 mM80-90
Zinc (Zn²⁺)0.1 mM50-60
Copper (Cu²⁺)0.1 mM70-80
Nickel (Ni²⁺)0.5 mM30-40

The enzyme shows high specificity for cobalt, with other divalent metal ions either failing to substitute or actively inhibiting the reaction. The inhibition by chelating agents like EDTA confirms the metal-dependent nature of the enzyme. For reconstitution of activity after purification, a specific ratio of ATP:Mg²⁺:Co²⁺ (1:2:0.5) typically provides optimal results .

How can heterologous expression of S. tokodaii cobS enhance cobalamin production in non-native hosts?

Heterologous expression of S. tokodaii cobS offers several strategic advantages for enhancing cobalamin production in non-native hosts:

Engineering Complete Biosynthetic Pathways:

  • Integration of the thermostable cobS gene into organisms with incomplete pathways

  • Construction of synthetic operons containing multiple cobalamin biosynthesis genes

  • Balancing expression levels of pathway components through promoter engineering

Advantages of Thermostable cobS:

  • Greater process stability at elevated temperatures

  • Resistance to proteolytic degradation

  • Potential for higher reaction rates at increased temperatures

  • Compatibility with thermophilic production hosts

Metabolic Engineering Considerations:

  • Ensure adequate precursor supply (uroporphyrinogen III, aminopropanol)

  • Balance cobalt availability without reaching toxic levels

  • Optimize ATP regeneration systems for energy-intensive reactions

  • Engineer redox balance to maintain proper electron flow

Expression Strategies in Model Organisms:

  • Codon optimization for the target host

  • Inclusion of appropriate secretion signals if extracellular production is desired

  • Integration at stable chromosomal loci for long-term expression

  • Use of inducible systems for controlled production

Successful implementation requires systematic optimization using design-of-experiments methodology to identify key process parameters and potential bottlenecks in the heterologous system .

What challenges exist in crystallizing S. tokodaii cobS for structural studies?

Researchers face several challenges when attempting to crystallize S. tokodaii cobS for structural studies:

Inherent Crystallization Challenges:

  • Conformational flexibility during catalytic cycle

  • Presence of disordered regions that impede crystal packing

  • Multiple oligomeric states depending on buffer conditions

  • Hydrophobic patches that may cause aggregation

Technical Approaches to Overcome Challenges:

How does S. tokodaii cobS activity compare with cobalamin synthases from other extremophiles?

Comparative analysis of S. tokodaii cobS with homologs from other extremophiles reveals notable differences in catalytic properties and stability profiles:

Comparison Across Extremophile Classes:

OrganismClassificationTemp. Optimum (°C)pH OptimumHalf-life at 80°CRelative ActivitySpecial Features
S. tokodaiiThermoacidophile75-852.5-3.5>120 min100%Acid-stable, cobalt-specific
Thermococcus kodakarensisHyperthermophile85-956.0-7.0>180 min110-120%Higher temperature optimum
Thermus thermophilusThermophile65-757.0-7.530-45 min70-80%Lower temperature requirement
Methanocaldococcus jannaschiiHyperthermophile80-906.0-6.5>150 min90-95%Strict anaerobic activity
Acidithiobacillus ferrooxidansAcidophile30-352.0-3.0<5 min40-50%Acid-stable but not thermostable
Haloferax volcaniiHalophile40-457.0-8.0<5 min30-35%Requires high salt (2-3M NaCl)

Key Mechanistic Differences:

  • S. tokodaii cobS shows unique adaptations to combined acid and heat stress

  • Halophilic homologs require different ion concentrations for stabilization

  • Anaerobic extremophiles may utilize alternative electron transfer mechanisms

  • Cold-adapted homologs display higher catalytic efficiency at lower temperatures but reduced stability

These comparisons highlight the specialized adaptations of S. tokodaii cobS to its native thermoacidophilic environment, particularly its ability to function at both high temperature and low pH, making it exceptionally valuable for certain biotechnological applications requiring these extreme conditions .

What bioprocess parameters should be optimized for maximal recombinant S. tokodaii cobS production?

Optimizing bioprocess parameters for maximal recombinant S. tokodaii cobS production requires systematic investigation of multiple factors:

Key Bioprocess Parameters to Consider:

  • Fermentation Variables:

    • Temperature profiles (induction at lower temperature than growth)

    • Dissolved oxygen levels (typically 30-40% saturation optimal)

    • pH control strategy (set-point and control mechanism)

    • Feeding strategy for high-density cultivation

  • Media Optimization:

    • Carbon source type and concentration

    • Nitrogen source composition

    • Trace element supplementation (particularly cobalt)

    • Inducer concentration and timing

  • Process Mode Selection:

    • Batch vs. fed-batch vs. continuous cultivation

    • Temperature-shift protocols

    • Two-stage processes separating growth and production phases

Design of Experiments Approach:
Implementation of a response surface methodology (RSM) with central composite design allows systematic evaluation of multiple parameters simultaneously, reducing experimental load while identifying optimal conditions and potential interactions between variables .

Process ParameterTypical RangeOptimal Value
Induction temperature16-37°C25-28°C
Inducer concentration0.1-1.0 mM IPTG0.3-0.4 mM
Cell density at inductionOD₆₀₀ 0.6-10OD₆₀₀ 3-4
Post-induction time4-24 hours16-18 hours
Agitation rate200-800 rpm400-500 rpm
Dissolved oxygen10-60%30-40%
pH6.8-7.57.0-7.2

A systematic optimization typically yields 3-5 fold improvements in volumetric productivity compared to standard conditions .

How can researchers engineer S. tokodaii cobS for enhanced catalytic efficiency?

Engineering S. tokodaii cobS for enhanced catalytic efficiency can be approached through several protein engineering strategies:

Rational Design Approaches:

  • Active Site Engineering:

    • Identify catalytic residues through structural analysis or homology modeling

    • Modify substrate binding pocket to improve affinity or specificity

    • Introduce mutations that stabilize transition states

  • Substrate Channel Optimization:

    • Engineer access tunnels to improve substrate entry and product release

    • Reduce potential bottlenecks in substrate trafficking

    • Modify residues that may cause steric hindrance

  • Domain Engineering:

    • Create chimeric enzymes combining domains from different cobalamin synthases

    • Optimize flexible linker regions between domains

    • Remove non-essential regions that may limit conformational changes

Directed Evolution Methods:

  • Library Generation:

    • Error-prone PCR with controlled mutation rates

    • Site-saturation mutagenesis at hotspot residues

    • DNA shuffling with homologous cobS genes

  • Selection/Screening Strategies:

    • Growth complementation in cobalamin auxotrophs

    • High-throughput colorimetric assays for cobS activity

    • FACS-based screening using fluorescent reporters

Computational Design:

  • Employ molecular dynamics simulations to identify flexible regions

  • Use quantum mechanics/molecular mechanics (QM/MM) to model transition states

  • Apply machine learning approaches to predict beneficial mutations

Engineering strategies should focus on maintaining thermostability while enhancing catalytic parameters. Often, combinations of rational design followed by directed evolution yield the most significant improvements, with documented cases achieving 5-20 fold increases in catalytic efficiency .

What strategies can improve the yield of functional S. tokodaii cobS in heterologous expression systems?

Improving functional yield of S. tokodaii cobS in heterologous expression systems requires addressing multiple aspects of protein production:

Gene and Vector Optimization:

  • Codon optimization based on host preferences (CAI >0.8)

  • Optimization of 5' mRNA structure to enhance translation initiation

  • Selection of appropriate promoters (strength and regulation)

  • Incorporation of efficient transcription terminators

  • Vector copy number adjustment based on toxicity assessment

Expression Host Considerations:

  • E. coli strains specialized for recombinant protein production (BL21, C41/C43)

  • Co-expression of molecular chaperones (GroEL/ES, ClpB, DnaK/J)

  • Use of strains with enhanced disulfide bond formation capability

  • Consideration of archaeal hosts for authentic post-translational modifications

Cultivation Strategy Optimization:

  • Induction Protocol:

    • Lower temperature cultivation (16-25°C)

    • Reduced inducer concentration (0.01-0.1 mM IPTG)

    • Auto-induction media for gradual protein accumulation

  • Media Composition:

    • Supplementation with enzyme cofactors (especially cobalt)

    • Addition of compatible solutes (betaine, ectoine)

    • Optimization of carbon and nitrogen sources

    • Trace metal supplementation

  • Process Parameters:

    • Controlled dissolved oxygen levels (30-40%)

    • pH maintenance in optimal range (6.8-7.2)

    • Feeding strategies for high-cell-density cultivation

Protein Engineering Approaches:

  • Fusion with solubility-enhancing partners (MBP, SUMO, NusA)

  • Addition of purification tags that enhance folding (His6, GST)

  • Surface charge modifications to improve solubility

  • Targeted mutagenesis of aggregation-prone regions

Implementing these strategies through design-of-experiments approaches allows efficient identification of critical parameters affecting functional yield. Successful optimization has been documented to increase soluble protein yields by 5-10 fold compared to standard conditions .

What are the most promising research directions for S. tokodaii cobS applications?

Current research trends indicate several promising directions for S. tokodaii cobS applications:

Fundamental Research:

  • Elucidation of the complete reaction mechanism through structural studies

  • Investigation of evolutionary relationships between archaeal and bacterial cobalamin synthases

  • Understanding thermoadaptation mechanisms at the molecular level

Biotechnological Applications:

  • Development of efficient cobalamin production platforms using engineered cobS

  • Creation of biosensors for cobalt detection in environmental samples

  • Design of biocatalysts for stereoselective metal incorporation reactions

  • Integration into synthetic biology frameworks for complete vitamin B12 production

Therapeutic and Medical Applications:

  • Engineering cobS variants for synthesis of cobalamin analogs with therapeutic potential

  • Development of novel antibiotics targeting pathogen-specific cobalamin biosynthesis

  • Creation of diagnostic tools based on cobalamin-dependent processes

The thermostable nature of S. tokodaii cobS makes it particularly valuable for processes requiring elevated temperatures or extended reaction times, potentially opening new application areas not accessible with mesophilic enzymes .

How might synthetic biology approaches incorporate S. tokodaii cobS into engineered pathways?

Synthetic biology approaches offer innovative strategies for incorporating S. tokodaii cobS into engineered pathways:

Modular Pathway Engineering:

  • Assembly of complete cobalamin biosynthetic pathways from diverse thermophilic sources

  • Creation of standardized genetic parts (promoters, RBSs) optimized for expression of thermostable enzymes

  • Development of temperature-responsive regulatory circuits controlling cobS expression

Chassis Engineering:

  • Adaptation of model organisms (E. coli, B. subtilis) for high-temperature operation

  • Construction of minimal synthetic cells with streamlined metabolism focused on cobalamin production

  • Engineering thermophilic organisms as production platforms with integrated cobS pathways

Pathway Optimization Strategies:

  • Flux Balancing:

    • Tuning expression levels of pathway enzymes to prevent bottlenecks

    • Engineering regulatory elements to coordinate expression of multiple genes

    • Implementing dynamic pathway regulation responsive to intermediate accumulation

  • Metabolic Channeling:

    • Creating enzyme fusion proteins to facilitate substrate transfer

    • Engineering scaffold proteins to co-localize sequential enzymes

    • Designing synthetic enzyme complexes mimicking natural metabolosomes

  • Cofactor Regeneration:

    • Integration of ATP regeneration systems to support energetically demanding steps

    • Engineering redox balance to maintain appropriate electron flow

    • Ensuring metal homeostasis for optimal cobalt incorporation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.