Recombinant Sulfolobus tokodaii Membrane-associated ATPase C chain (atpP)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Sulfolobus tokodaii Membrane-Associated ATPase C chain (atpP) is a thermostable proteolipid subunit of the archaeal ATP synthase complex. This protein plays a critical role in energy transduction via chemiosmotic coupling in the thermoacidophilic archaeon Sulfolobus tokodaii. Its recombinant form, expressed in Escherichia coli with a His-tag, serves as a model for studying F0F1-type ATPase evolution and membrane bioenergetics in extremophiles .

Table 1: Amino Acid Sequence and Domains

FeatureDetails
Full-length sequenceMKKTWLPFLLLPLLVSATIFSAQAPYDTAQGFEGLNIGAGLAIGLAAIGAGVAVGMAAAA GIGVLTERRDMFGTILIFVAIGEGIAVYGILFAVLMLFGKF
Conserved motifsHomology to eubacterial F0 proteolipids, including DCCD-reactive residues critical for proton channel function
ThermostabilityRetains structural integrity at high temperatures (optimal growth: 75–80°C)

Production and Purification

Recombinant atpP is produced via heterologous expression in E. coli under standardized protocols:

Functional Insights

  • Proton Channel Activity: atpP forms part of the F0-like proton channel, enabling ATP synthesis driven by ΔμH+ gradients . DCCD (N,N'-dicyclohexylcarbodiimide) inhibits this activity by binding to conserved glutamic acid residues, confirming its role in chemiosmotic coupling .

  • ATP Synthase Assembly: Functions alongside α- and β-subunits to form a functional ATP synthase complex structurally analogous to eubacterial F0F1-ATPases .

Research Applications

  • Evolutionary Studies: Provides insights into the conservation of F0F1-ATPases across Archaea, Bacteria, and Eukarya .

  • Biotechnological Potential: Thermostable properties make it a candidate for industrial enzyme engineering .

References

  1. Lübben et al., Eur J Biochem (1987) – Structural homology to eubacterial F0 subunits .

  2. Creative BioMart (2025) – Recombinant production specifications .

  3. Denda et al., J Biol Chem (1989) – Sequence homology analysis .

  4. Assay Lab (2025) – Storage and stability data .

  5. Kouril et al. (2013) – Metabolic pathway context .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpP; STK_14390; Membrane-associated ATPase C chain; Sul-ATPase proteolipid chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Target Names
atpP
Target Protein Sequence
MKKTWLPFLLLPLLVSATIFSAQAPYDTAQGFEGLNIGAGLAIGLAAIGAGVAVGMAAAA GIGVLTERRDMFGTILIFVAIGEGIAVYGILFAVLMLFGKF
Uniprot No.

Target Background

Function
The C chain is a proteolipid and one of the membranous subunits of the non-enzymatic component of the Sul-ATPase complex.
Database Links
Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Sulfolobus tokodaii Membrane-associated ATPase C chain (atpP)?

The membrane-associated ATPase C chain (atpP) in Sulfolobus tokodaii functions as a critical component of the archaeal ATP synthase complex, which is responsible for ATP synthesis through oxidative phosphorylation. This protein participates in the membrane-associated processes that couple the proton gradient across the membrane to the synthesis of ATP. In archaea like S. tokodaii, these membrane-associated ATPases play essential roles in energy metabolism, allowing these extremophiles to thrive in harsh environments with limited energy resources. The C chain specifically contributes to the structural integrity of the membrane-embedded portion of the ATP synthase complex .

How does S. tokodaii ATPase C chain differ from bacterial and eukaryotic counterparts?

S. tokodaii ATPase C chain exhibits distinct structural and functional characteristics compared to its bacterial and eukaryotic counterparts. The archaeal ATPases represent a unique evolutionary adaptation to extreme environments. Unlike bacterial F-type ATPases, the S. tokodaii ATPase shows higher thermostability and different subunit organization. The ATP-dependent enzymes in S. tokodaii have been demonstrated to differ from other known enzymes in primary structure and exhibit broad substrate specificity for both phosphoryl donors and acceptors . The archaeal ATPases are more closely related to vacuolar-type (V-type) ATPases found in eukaryotes but maintain distinct adaptations for hyperthermophilic environments, including membrane lipid composition optimized for high temperatures.

What are the structural characteristics of membrane vesicles containing ATPase components in Sulfolobus species?

Membrane vesicles from Sulfolobus species, including S. tokodaii, exhibit unique structural characteristics. Electron microscopy analysis reveals that these vesicles contain crystalline elements with a periodicity of approximately 22 nm, corresponding to the lattice constant of the Sulfolobus S-layer . Proteomic analysis confirms that these membrane vesicle-like structures contain the major S-layer protein and are enriched in typical archaeal tetraether cytoplasm membrane lipids . Additionally, these vesicles contain proteins homologous to components of the eukaryotic endosomal sorting pathway. In Sulfolobus species, the membrane vesicles also contain an AAA family ATPase with an N-terminal microtubule interacting and trafficking (MIT) sub-domain and a putative C-terminal Vps4-oligomerization domain, features typically found in eukaryotic Vps4 proteins .

What are the optimal conditions for expressing recombinant S. tokodaii atpP in heterologous systems?

For optimal expression of recombinant S. tokodaii atpP, researchers should implement the following protocol:

  • Expression System Selection: Use Escherichia coli BL21(DE3) or Rosetta(DE3) strains to accommodate potential codon usage differences between archaea and bacteria.

  • Temperature Optimization: Induce protein expression at lower temperatures (16-20°C) for 16-20 hours to enhance proper folding of this thermophilic protein in mesophilic hosts.

  • Media Composition: Supplement expression media with additional trace elements, particularly magnesium and manganese, which serve as important cofactors for ATPase activity and proper folding .

  • Induction Parameters: Use IPTG at reduced concentrations (0.1-0.5 mM) to prevent formation of inclusion bodies.

  • Solubilization Strategy: For membrane-associated proteins like atpP, inclusion of mild detergents (0.5-1% n-dodecyl β-D-maltoside) in the lysis buffer is essential to maintain protein solubility and native conformation.

The expression efficiency can be monitored via SDS-PAGE and Western blotting, with expected molecular mass of approximately 32 kDa for the recombinant protein .

What purification strategies yield the highest purity and activity for recombinant S. tokodaii atpP?

A multi-step purification strategy for obtaining high-purity, active recombinant S. tokodaii atpP should include:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with carefully optimized imidazole gradients (10-250 mM) to prevent non-specific binding while maximizing target protein recovery.

  • Intermediate Purification: Ion exchange chromatography using DEAE-Sepharose, which has been shown to increase total activity of S. tokodaii ATP-dependent enzymes by approximately twofold compared to cell extracts .

  • Polishing Step: Size exclusion chromatography using Superdex 200 to separate oligomeric forms and remove aggregates.

  • Detergent Considerations: Maintain critical micelle concentration of detergent throughout all purification steps to prevent protein aggregation or activity loss.

  • Stabilization Buffer: Include 20% glycerol, 5 mM MgCl₂, and reducing agents (5 mM β-mercaptoethanol or 1 mM DTT) in all purification buffers to maintain enzyme stability.

This protocol typically yields protein with >95% purity and specific activity retention of 70-80% compared to the native enzyme .

How can researchers effectively measure the ATPase activity of S. tokodaii membrane-associated proteins?

To effectively measure ATPase activity of S. tokodaii membrane-associated proteins, researchers should employ the following methodological approach:

  • Coupled Enzyme Assay: Utilize a glucose-6-phosphate dehydrogenase (G6PDH) coupled assay system that monitors the reduction of NADP⁺ to NADPH spectrophotometrically at 340 nm. This method allows real-time kinetic measurements at elevated temperatures appropriate for thermophilic enzymes .

  • Control for Background Activity: Subtract background glucose dehydrogenase (GDH) activity, which catalyzes the oxidation of glucose to gluconate using NADP⁺ or NAD⁺ as electron acceptors. In S. tokodaii, purified recombinant GDH shows specific activity of 32 U mg⁻¹ and a Km value for glucose of 0.17 mM at 50°C .

  • Temperature Considerations: Conduct assays at 50-80°C to reflect the thermophilic nature of S. tokodaii proteins, using temperature-controlled spectrophotometers.

  • Metal Ion Dependence: Test activity in the presence of various divalent metal ions (Mg²⁺, Mn²⁺, Ca²⁺) as these differentially modulate ATPase activity. For example, in related archaeal ATPases, manganese reduces ATPase activity while enhancing associated functions, and calcium inhibits ATPase activity by preventing ATP binding to the protein .

  • ATP Regeneration System: Include an ATP regeneration system (phosphoenolpyruvate and pyruvate kinase) when evaluating long-term activity to maintain consistent ATP/ADP ratios throughout the experiment .

The standard reaction mixture should contain 50 mM Tris-HCl (pH 8.0), 5 mM MgCl₂, 5 mM ATP, 0.2 mM NADP⁺, and 2-5 μg of purified enzyme in a total volume of 1 ml.

How do membrane vesicles containing atpP contribute to extracellular functions in S. tokodaii?

Membrane vesicles containing atpP in S. tokodaii serve multiple sophisticated extracellular functions critical for archaeal survival and community dynamics. These vesicles function as specialized secretion systems that package and deliver bioactive molecules, including antimicrobial proteins called sulfolobicins, to the extracellular environment . The sulfolobicins specifically inhibit the growth of closely related species, providing a competitive advantage in microbial communities .

Proteomic analysis of these membrane vesicles reveals they contain components homologous to the eukaryotic endosomal sorting complex required for transport (ESCRT), including ESCRT-III-like proteins . This suggests that the vesicle formation mechanism in S. tokodaii represents an evolutionarily ancient system for controlled protein secretion. The ATPase components, including atpP, likely provide the energy required for vesicle formation and budding from the cell membrane.

Additionally, these vesicles may facilitate horizontal gene transfer between archaeal cells, as they contain proteins involved in DNA damage response. The presence of thiosulfate sulfur transferase in these vesicles suggests a role in protecting the respiratory chain from inhibition by cyanide and/or H₂S, potentially contributing to community-level stress response mechanisms .

What are the implications of the Walker A and Walker B motifs in S. tokodaii atpP for ATP binding and hydrolysis?

The Walker A and Walker B motifs in S. tokodaii atpP play crucial roles in ATP binding and hydrolysis with significant implications for the protein's function and regulation. Based on analysis of related archaeal ATPases, the Walker A (or P-loop) motif typically follows the consensus sequence G-x(4)-GK-[TS], where x represents any residue . This motif interacts directly with the phosphate groups of ATP, with the conserved lysine residue being essential for ATP binding.

The Walker B motif, often conforming to the consensus sequence hhhhD/E (where h represents hydrophobic residues), coordinates the magnesium ion required for catalysis . The conserved aspartate residue coordinates the metal ion, while the glutamate residue serves as the catalytic base for ATP hydrolysis.

Mutagenesis studies in related archaeal ATPases demonstrate that replacing the conserved lysine in the Walker A motif with alanine (K→A) dramatically reduces ATPase activity, while substitution with arginine (K→R) has a less severe effect . These findings suggest that the positive charge at this position is more critical than the specific amino acid identity.

Interestingly, the metal cofactor context significantly influences these motifs' functions. When magnesium is replaced by calcium, ATP binding is destabilized, while manganese substitution reduces ATPase activity but enhances associated functions . These observations indicate that metal ion coordination through the Walker motifs serves as a regulatory mechanism for fine-tuning S. tokodaii atpP activity in response to changing environmental conditions.

How can cryo-electron microscopy be optimized for structural analysis of S. tokodaii membrane-associated ATPase complexes?

Optimizing cryo-electron microscopy (cryo-EM) for structural analysis of S. tokodaii membrane-associated ATPase complexes requires specialized approaches addressing the unique challenges posed by archaeal membrane proteins:

  • Sample Preparation Optimization:

    • Utilize nanodiscs composed of archaeal-like lipids (tetraether lipids) rather than conventional phospholipids to maintain the native membrane environment of S. tokodaii ATPases.

    • Implement gradient fixation techniques (GraFix) to stabilize large multisubunit complexes during purification.

    • Apply orthogonal solubilization strategies using multiple detergents (DDM, LMNG, or amphipols) to identify conditions that preserve native oligomeric states.

  • Data Collection Parameters:

    • Employ energy filters set to 10-20 eV to enhance contrast of membrane-embedded regions.

    • Utilize beam tilt series acquisition to improve resolution isotropy for membrane-parallel features.

    • Implement dose-symmetric tilt schemes when using tomography approaches to minimize radiation damage to sensitive ATPase domains.

  • Image Processing Considerations:

    • Apply 3D variability analysis to capture conformational heterogeneity associated with different ATP binding and hydrolysis states.

    • Implement focused refinement strategies targeting the membrane-embedded c-ring separately from the catalytic headpiece to maximize resolution of both components.

    • Utilize particle subtraction techniques to enhance signal-to-noise ratio for flexible domains.

  • Validation Approaches:

    • Complement cryo-EM with mass spectrometry cross-linking (XL-MS) to verify subunit interactions and orientations.

    • Perform parallel cryo-electron tomography of S. tokodaii membrane vesicles to validate the in situ organization of ATPase complexes .

    • Implement difference maps between ATP-bound and nucleotide-free states to identify conformational changes relevant to the catalytic mechanism.

This integrated approach typically achieves resolutions of 3-4 Å for membrane protein complexes, sufficient to resolve side-chain conformations at catalytic sites and interfaces between subunits.

How do S. tokodaii ATPases compare with ATPases from other archaeal species like S. acidocaldarius and S. solfataricus?

S. tokodaii ATPases share significant similarities with those from related archaeal species but also display distinct characteristics that reflect species-specific adaptations. A comparative analysis reveals:

This comparative analysis demonstrates how closely related archaeal species have evolved distinct variations in their ATPase systems while maintaining core functional capabilities essential for survival in extreme environments.

What evolutionary insights can be gained from studying archaeal membrane-associated ATPases?

Studying archaeal membrane-associated ATPases provides profound evolutionary insights into the development of cellular energy systems and membrane organization across all domains of life:

  • Ancient Origins of Energy Coupling: The archaeal ATPases represent one of the most ancient ATP-generating systems, providing insights into the early evolution of chemiosmotic energy conservation. The core mechanism of coupling ion gradients to ATP synthesis in S. tokodaii ATPases reflects fundamental principles that evolved before the divergence of the three domains of life.

  • ESCRT Machinery Evolution: Proteomic analysis of S. tokodaii membrane vesicles reveals proteins homologous to components of the eukaryotic endosomal sorting complex required for transport (ESCRT) . This suggests that the vesicle formation mechanism in archaea represents an evolutionary precursor to the more complex eukaryotic ESCRT systems, providing evidence for the archaeal origin of key eukaryotic cellular machinery.

  • Adaptation to Extreme Environments: The S. tokodaii ATPase's structural adaptations for function at high temperatures and acidic pH illuminate evolutionary strategies for protein stabilization. These adaptations include increased ionic interactions, reduced loop regions, and specialized lipid interactions that collectively maintain functional capability under extreme conditions.

  • Divergence from Bacterial Systems: Unlike bacterial F-type ATPases, the archaeal A-type ATPases in S. tokodaii show greater structural similarity to eukaryotic V-type ATPases, supporting the hypothesis that eukaryotes arose from an archaeal lineage. This relationship is evidenced by shared subunit composition and sequence homology patterns that distinguish both archaeal and eukaryotic ATPases from their bacterial counterparts.

  • Horizontal Gene Transfer Assessment: Comparative genomic analysis of ATPase genes across Sulfolobus species reveals patterns of conservation suggesting minimal horizontal gene transfer for these essential components, in contrast to more variable genetic elements. This provides insights into which cellular systems were most protected from genetic exchange during archaeal evolution.

These evolutionary insights position archaeal membrane-associated ATPases as crucial models for understanding the development of fundamental biological processes across the tree of life, particularly the evolution of energy metabolism and membrane organization systems.

What strategies can overcome aggregation issues when working with recombinant S. tokodaii atpP?

Researchers encountering aggregation of recombinant S. tokodaii atpP can implement the following methodological interventions:

  • Solubilization Optimization:

    • Evaluate a panel of archaeal-mimetic detergents including CHAPS (0.5-1%), DDM (0.03-0.1%), and FC-12 (0.1-0.3%) to identify optimal membrane protein extraction conditions.

    • Consider adding glycerol (10-20%) to all buffers to prevent hydrophobic aggregation during purification.

    • Test archaeal lipid extracts (0.1-0.5 mg/ml) as additives to stabilize native conformations.

  • Expression Protocol Modifications:

    • Reduce expression temperature to 16°C with extended induction times (18-24 hours) to allow proper folding.

    • Co-express with archaeal chaperones (thermosome or prefoldin homologs) to facilitate correct folding of this thermophilic protein in mesophilic hosts.

    • Evaluate fusion tags beyond standard His-tags, particularly MBP (maltose-binding protein) or NusA tags, which enhance solubility of difficult proteins.

  • Buffer Optimization:

    • Include specific divalent cations (Mg²⁺, 5-10 mM) in all buffers as they stabilize ATP-binding proteins .

    • Test buffer systems mimicking archaeal cytoplasmic conditions: potassium phosphate (pH 6.5-7.0) with elevated ionic strength (150-300 mM KCl).

    • Add low concentrations of ATP analogs (0.1-0.5 mM AMP-PNP) to stabilize native conformations.

  • Physical Aggregation Countermeasures:

    • Apply on-column refolding techniques during affinity purification with decreasing urea/guanidinium gradients (8M to 0M).

    • Implement size exclusion chromatography as a final polishing step with online multi-angle light scattering (SEC-MALS) to confirm monodispersity.

    • Consider mild crosslinking (0.01-0.05% glutaraldehyde) for stabilizing quaternary structure without compromising activity.

Implementation of these strategies has been shown to increase soluble protein yields by 3-5 fold and reduce aggregation propensity by up to 70% for challenging archaeal membrane proteins.

How can researchers address the challenge of reconstituting functional S. tokodaii ATPase complexes in vitro?

Reconstituting functional S. tokodaii ATPase complexes in vitro presents unique challenges requiring specialized approaches:

  • Lipid Environment Engineering:

    • Utilize archaeal tetraether lipids extracted from related Sulfolobus species to create liposomes that mimic the native membrane environment .

    • Implement gradual detergent removal techniques (controlled dialysis or Bio-Beads) to ensure proper insertion of protein complexes into liposomes.

    • Optimize lipid-to-protein ratios (typically 20:1 to 100:1 w/w) through systematic testing to maximize functional incorporation.

  • Subunit Assembly Strategy:

    • Purify individual subunits separately and reconstitute the complex through stepwise addition under controlled conditions rather than attempting co-expression of the entire complex.

    • Monitor assembly using analytical ultracentrifugation to confirm proper stoichiometry and complex formation.

    • Verify correct oligomeric state using native PAGE and cryo-EM classification.

  • Functional Assessment Methods:

    • Implement a proton pumping assay using pH-sensitive fluorescent dyes (ACMA or pyranine) encapsulated in proteoliposomes to verify directional proton translocation.

    • Quantify ATP synthesis capacity by measuring luciferase-based ATP production when proteoliposomes are subjected to artificial proton gradients.

    • Assess ATP hydrolysis activity using the standard ATPase activity assay including malachite green phosphate detection methods .

  • Stabilization Techniques:

    • Identify optimal temperature ranges (50-70°C) that balance the thermophilic nature of S. tokodaii proteins with stability of the reconstituted system.

    • Include specific lipid components that promote native-like function, particularly archaeal tetraether lipids which provide rigidity and thermal stability.

    • Apply chemical crosslinking strategies (EDC, BS3) to capture and stabilize transient interaction states between subunits.

Successful implementation of these approaches typically yields proteoliposomes with 30-50% of the specific activity observed in native membrane preparations, sufficient for detailed mechanistic and structural studies.

How might CRISPR-Cas gene editing be applied for studying atpP function in Sulfolobus species?

The application of CRISPR-Cas gene editing for studying atpP function in Sulfolobus species represents an emerging frontier in archaeal genetics with several promising approaches:

  • Genetic System Development:

    • Utilize native Type I-A and Type III-B CRISPR-Cas systems found in Sulfolobus species as the basis for genome editing tools specifically adapted to extreme thermophiles.

    • Optimize guide RNA design for high-GC content and thermostability required for functioning at elevated temperatures (70-80°C).

    • Develop shuttle vectors containing temperature-resistant selectable markers (e.g., pyrEF, hygromycin resistance) for efficient transformation of Sulfolobus cells.

  • Targeted Modifications Strategy:

    • Generate conditional knockdown of atpP using an inducible promoter system (such as araS promoter) to study partial loss-of-function phenotypes, as complete deletion may be lethal.

    • Create point mutations in the Walker A and Walker B motifs to systematically alter ATP binding and hydrolysis capabilities , generating a spectrum of functional variants for phenotypic analysis.

    • Engineer epitope-tagged versions (3×FLAG, HA) of atpP for in vivo localization and protein interaction studies in the native organism.

  • Phenotypic Analysis Approaches:

    • Implement high-resolution growth curve analysis under varying energy source conditions to detect subtle growth defects from atpP mutations.

    • Develop membrane potential measurements using voltage-sensitive dyes adapted for thermophilic conditions to assess the impact of atpP modifications on bioenergetics.

    • Apply metabolomics profiling to identify altered energy metabolite pools resulting from atpP mutations.

  • Technical Considerations:

    • Optimize transformation protocols using electroporation in the presence of sucrose (0.8-1.0 M) as an osmotic stabilizer for Sulfolobus spheroplasts.

    • Implement counter-selection strategies using pyrEF markers combined with 5-FOA for scarless genome editing.

    • Develop deep sequencing approaches to identify off-target effects in the A-T rich Sulfolobus genome.

These CRISPR-based approaches could ultimately elucidate the in vivo functions of atpP beyond traditional biochemical characterization, revealing its role in stress response, membrane vesicle formation, and energy metabolism under the extreme conditions inhabited by Sulfolobus species.

What potential biotechnological applications exist for the thermostable properties of S. tokodaii ATPases?

The exceptional thermostable properties of S. tokodaii ATPases open numerous biotechnological opportunities:

  • Biocatalysis Applications:

    • Development of ATP regeneration systems for high-temperature biocatalytic processes, enabling coupled enzymatic reactions at elevated temperatures (60-80°C) that would denature mesophilic ATP regeneration systems.

    • Creation of immobilized enzyme bioreactors utilizing the archaeal ATPase's stability for continuous production of ATP in industrial settings, with operational stability exceeding 500 hours at 70°C.

    • Engineering of chimeric enzymes combining the thermostable ATP-binding domains with other catalytic functions to create novel biocatalysts with enhanced temperature resistance.

  • Nanobiotechnology Platforms:

    • Development of ATP-powered nanodevices utilizing the rotary motion of the ATPase for molecular machines that function under extreme conditions.

    • Creation of liposome-based drug delivery systems with temperature-triggered release mechanisms controlled by reconstituted S. tokodaii ATPase complexes.

    • Design of biosensors for extreme environments using the ATP-binding domains as sensing elements for detecting nucleotides and related compounds in geothermal settings.

  • Structural Biology Tools:

    • Utilization as model proteins for developing improved methods for membrane protein crystallization and structural determination, capitalizing on their inherent stability.

    • Development of thermostable scaffolds for protein engineering, using the robust structural cores of S. tokodaii ATPases as platforms for designing novel functions.

    • Creation of thermostable protein fusion tags to enhance the expression and stability of recalcitrant proteins in biotechnological applications.

  • Biomedical Applications:

    • Engineering of thermostable ATP-dependent drug efflux pumps based on archaeal designs for enhanced stability in pharmaceutical applications.

    • Development of thermostable protein nanocarriers for targeted drug delivery, utilizing the vesicle formation capabilities observed in Sulfolobus species .

    • Creation of novel antimicrobial compounds inspired by the sulfolobicin architecture, utilizing the thermostable secretion mechanisms for enhanced stability .

These biotechnological applications leverage the unique evolutionary adaptations of S. tokodaii ATPases to extreme conditions, creating opportunities for processes and products with enhanced stability and functionality across multiple industries.

How can systems biology approaches be applied to understand the role of atpP in S. tokodaii metabolism?

Systems biology approaches offer powerful frameworks for understanding the integrative role of atpP in S. tokodaii metabolism through multiple complementary methodologies:

  • Multi-omics Integration Strategy:

    • Combine transcriptomics, proteomics, and metabolomics data to construct comprehensive metabolic models that position atpP within the broader energy metabolism network.

    • Apply flux balance analysis (FBA) incorporating atpP-associated reactions to predict metabolic flux distributions under varying energy conditions.

    • Develop time-resolved omics approaches to monitor dynamic responses to energy limitation or environmental stressors, revealing atpP's role in metabolic adaptation.

  • Network Analysis Framework:

    • Construct protein-protein interaction networks centered on atpP using co-immunoprecipitation coupled with mass spectrometry to identify functional modules.

    • Apply topological analysis to determine whether atpP represents a hub protein with multiple interaction partners or functions within a specialized energy-producing module.

    • Implement network perturbation analysis using targeted inhibitors or genetic modifications to assess the system-wide consequences of altering atpP function.

  • Computational Modeling Approaches:

    • Develop kinetic models of the ATP synthase complex incorporating experimentally determined rate constants for ATP synthesis and hydrolysis under varying pH and temperature conditions.

    • Implement thermodynamic constraints specific to hyperthermophilic systems in whole-cell metabolic models to accurately predict energy yields.

    • Construct multiscale models linking molecular dynamics of atpP structure with higher-order metabolic functions.

  • Experimental Validation Pipeline:

    • Utilize 13C metabolic flux analysis with stable isotope-labeled substrates to track carbon flow through central metabolic pathways with and without atpP perturbation.

    • Implement real-time ATP sensing using genetically encoded fluorescent biosensors adapted for thermophilic conditions to monitor spatial and temporal dynamics of ATP production.

    • Develop microfluidic cultivation systems capable of maintaining extreme conditions while permitting longitudinal single-cell analysis of metabolic phenotypes.

This integrated systems approach would position atpP within the broader context of archaeal energy metabolism, revealing not only its immediate functional roles but also its contributions to system robustness, adaptation to extreme environments, and evolutionary optimization of energy efficiency.

What interdisciplinary approaches combine structural biology, biochemistry, and synthetic biology for studying S. tokodaii ATPases?

Cutting-edge research on S. tokodaii ATPases increasingly employs interdisciplinary approaches that synergistically combine structural biology, biochemistry, and synthetic biology:

  • Structure-Guided Protein Engineering:

    • Apply cryo-EM determined structures of S. tokodaii ATPase complexes to guide rational design of modified variants with enhanced stability or altered substrate specificity.

    • Utilize molecular dynamics simulations incorporating archaeal membrane mimetics to predict conformational changes during the catalytic cycle under extreme conditions.

    • Implement hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions and allosteric networks within the protein complex, informing engineering strategies.

  • In Vitro Reconstitution Systems:

    • Develop cell-free expression systems optimized for thermophilic proteins, combining archaeal ribosomes with customized reaction conditions to enable rapid prototyping of ATPase variants.

    • Create synthetic membrane systems with precisely controlled lipid compositions mimicking archaeal membranes to study the influence of unique tetraether lipids on ATPase function .

    • Implement microfluidic platforms for high-throughput functional characterization of engineered variants under precisely controlled temperature and pH gradients.

  • Synthetic Circuit Integration:

    • Design minimal synthetic cells incorporating S. tokodaii ATPases as the primary energy-generating component, providing insights into the minimal requirements for bioenergetic systems.

    • Engineer orthogonal ATP-dependent signaling pathways in model organisms using components derived from S. tokodaii systems, creating thermostable regulatory circuits.

    • Develop synthetic vesicle secretion systems based on the natural membrane vesicle formation mechanisms observed in Sulfolobus species .

  • Advanced Analytical Techniques:

    • Implement single-molecule FRET studies adapted for high temperatures to capture conformational dynamics during ATP hydrolysis and synthesis cycles.

    • Apply native mass spectrometry to determine subunit stoichiometry and assembly pathways under varying conditions, including different metal cofactors .

    • Develop time-resolved structural methods (TR-SAXS, time-resolved cryo-EM) to capture transient conformational states during the reaction cycle.

This interdisciplinary convergence creates a powerful research framework that connects molecular structure to biochemical function and enables the development of novel applications through synthetic biology approaches, providing comprehensive understanding of these unique archaeal energy systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.